Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5387
Gene name	PMS1 homolog 2, mismatch repair system component pseudogene 3
Gene symbol	PMS2P3
Synonyms (NCBI Gene)	PMS2L3PMS2L9PMS5PMSR3
Chromosome	7
Chromosome location	7q11.23

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence
GO:0003674	Function	Molecular_function	ND
GO:0005575	Component	Cellular_component	ND
GO:0006298	Process	Mismatch repair	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008150	Process	Biological_process	ND
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0032300	Component	Mismatch repair complex	IEA
GO:0140664	Function	ATP-dependent DNA damage sensor activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q13401

Protein name

Putative postmeiotic segregation increased 2-like protein 3 (PMS2-related protein 3) (Postmeiotic segregation increased 2-like protein 9) (Postmeiotic segregation increased protein 5) (Putative postmeiotic segregation increased 2 pseudogene 3)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	7 → 48	KRAB box	Family
PF13589	HATPase_c_3	108 → 167		Domain

Sequence

MNTLQGPVSFKDVAVDFTQEEWRQLDPDEKIAYGDVMLENYSHLVSVGYDYHQAKHHHGV
EVKEVEQGEEPWIMEGEFPCQHSPEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVEN
SLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLISFSSETSHM

Sequence length

168

Interactions

View interactions

Related Genes Genes most often co-reported with PMS2P3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PMS2P3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PMS2P3 (see Related Genes above), that are NOT already directly curated for PMS2P3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PMS2P3.

PMS2P3 (PMS1 homolog 2, mismatch repair system component pseudogene 3)

Save This Analysis