PMS2P11 (PMS1 homolog 2, mismatch repair system component pseudogene 11)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 107161145
Gene name PMS1 homolog 2, mismatch repair system component pseudogene 11
Gene symbol PMS2P11
Synonyms (NCBI Gene)
PMS2L11PMSR6
Chromosome 7
Chromosome location 7q11.23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016301 Function Kinase activity IEA
GO:0016740 Function Transferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 9125 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13670
Protein name Putative postmeiotic segregation increased 2-like protein 11 (PMS2-related protein 6) (Putative postmeiotic segregation increased 2 pseudogene 11)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13589 HATPase_c_3 179 → 247 Domain
Sequence 
MEKLSAASGYSDVTDSKAMGPLAVGCLTKCSHAFHLLCLLAMYCNGNKGPEHPNPGKPFT
ARGFPASATFQTTPGPQASRGFQNPETLADIPASPQLLTDGHYMTLPVSPDQLPCDDPMA
GSGGAPVLRVGHDHGCHQQPRICNAPLPGPGPYRTEPAKAIKPIDRKSVHQICSGPVVLS
LSTAVKELVENSLDAGATNIDLKLKDYGMDLIEVSGNGCGVEEENFEGLMMSPFLPATSR
RRLGLDWCLITMGKSSRRPPTPTPEGPQSA
Sequence length 270
Interactions View interactions

No strongly related genes found yet for PMS2P11.

No additional diseases found yet through genes similar to PMS2P11.