PMS2CL (PMS2 C-terminal like (pseudogene))
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 441194 |
| Gene name | PMS2 C-terminal like (pseudogene) |
| Gene symbol | PMS2CL |
| Synonyms (NCBI Gene) |
PMS2P13
|
| Chromosome | 7 |
| Chromosome location | 7p22.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q68D20 |
| Protein name | Protein PMS2CL (PMS2-C terminal-like protein) |
| Family and domains | |
| Sequence |
MHAADLEKPMVEKQDQSPSLRTGEEKRDVSISRLREAFSLRHTTENKPHSPKTPEPRRSP |
| Sequence length | 193 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with PMS2CL across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to PMS2CL (see Related Genes above), that are NOT already directly curated for PMS2CL itself -- a lead worth checking, not a confirmed association.
0
|
|