PMCHL2 (pro-melanin concentrating hormone like 2 (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 5370
Gene name Pro-melanin concentrating hormone like 2 (pseudogene)
Gene symbol PMCHL2
Synonyms (NCBI Gene)
-
Chromosome 5
Chromosome location 5q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0007165 Process Signal transduction IEA
GO:0007268 Process Chemical synaptic transmission IEA
GO:0030354 Function Melanin-concentrating hormone activity IEA
GO:0031777 Function Type 1 melanin-concentrating hormone receptor binding IBA
GO:0032227 Process Negative regulation of synaptic transmission, dopaminergic IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
176794 9111 ENSG00000290836
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BQD1
Protein name Putative pro-MCH-like protein 2 (Pro-melanin-concentrating hormone-like protein 2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05824 Pro-MCH 3 → 86 Pro-melanin-concentrating hormone (Pro-MCH) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis but not in brain.
Sequence 
MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSA
KFPIGRRDFDTLRCMLGRVYQRCWQV
Sequence length 86
Interactions View interactions

No strongly related genes found yet for PMCHL2.

No additional diseases found yet through genes similar to PMCHL2.