PLSCR2 (phospholipid scramblase 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 57047
Gene name Phospholipid scramblase 2
Gene symbol PLSCR2
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3q24
Summary This gene encodes a member of the phospholipid scramblase family. Phospholipid scramblases are membrane proteins that mediate calcium-dependent, non-specific movement of plasma membrane phospholipids and phosphatidylserine exposure. The encoded protein co
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18 Show/Hide all (18)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding NAS 10930526
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IDA 24648509
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607610 16494 ENSG00000163746
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NRY7
Protein name Phospholipid scramblase 2 (PL scramblase 2) (Ca(2+)-dependent phospholipid scramblase 2)
Protein function May catalyze calcium-induced ATP-independent rapid bidirectional and non-specific movement of phospholipids (lipid scrambling or lipid flip-flop) between the inner and outer leaflet of the plasma membrane. ; FUNCTIO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03803 Scramblase 74 → 295 Scramblase Domain
Tissue specificity TISSUE SPECIFICITY: Expression of isoform 1 seems restricted to testis. {ECO:0000269|PubMed:10930526}.
Sequence 
MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYLVPPAGTAGIP
VQNQPGRPEGVPWMPAPPPPLNCPPGLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIK
NSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVITLERPLRCNCCCCPCCLQE
IEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLDE
QIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFERTR
Sequence length 297
Interactions View interactions

No strongly related genes found yet for PLSCR2.

No additional diseases found yet through genes similar to PLSCR2.