Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	126520
Gene name	Polo like kinase 5 (inactive)
Gene symbol	PLK5
Synonyms (NCBI Gene)	PLK-5PLK5PSgK384ps
Chromosome	19
Chromosome location	19p13.3

22 Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000776	Component	Kinetochore	IBA
GO:0000922	Component	Spindle pole	IBA
GO:0002357	Process	Defense response to tumor cell	IDA	21245385
GO:0004672	Function	Protein kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21245385
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0006974	Process	DNA damage response	IBA
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0010564	Process	Regulation of cell cycle process	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IDA	21245385
GO:0030154	Process	Cell differentiation	IEA
GO:0042981	Process	Regulation of apoptotic process	IMP	21245385
GO:0051301	Process	Cell division	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IDA	21245385
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IBA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IMP	21245385

MIM	HGNC	e!Ensembl
621048	27001	ENSG00000185988

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q496M5
Protein name	Inactive serine/threonine-protein kinase PLK5 (Polo-like kinase 5) (PLK-5)
Protein function	Inactive serine/threonine-protein kinase that plays a role in cell cycle progression and neuronal differentiation.
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in the brain, neurons and glial cells. Also expressed in highly differentiated cells, such as the serous acini in the parotid gland, distal and proximal tubules of the kidney, tubules of the seminal gland, Kupffer cells and s
Sequence	MYTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLL QDDFFTQGFTPDRLPAHSCHSPPIFAIPPPLGRIFRKVGQRLLTQCRPPCPFTPKEASGP GEGGPDPDSMEWDGESSLSAKEVPCLEGPIHLVAQGTLQSDLAGPEGSRRPEVEAALRHL QLCLDVGPPATQDPLGEQQPILWAPKWVDYSSKYGFGYQLLDGGRTGRHPHGPATPRREG TLPTPVPPAGPGLCLLRFLASEHALLLLFSNGMVQVSFSGVPAQLVLSGEGEGLQLTLWE QGSPGTSYSLDVPRSHGCAPTTGQHLHHALRMLQSI
Sequence length	336
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Familial cancer of breast	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Astrocytoma	Astrocytoma	BEFREE	21245385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21245385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	36304471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26908440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26908440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21245385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35256538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21245385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26908440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26908440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	21245385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21245385		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with PLK5 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PLK5.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PLK5 (see Related Genes above), that are NOT already directly curated for PLK5 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PLK5.

PLK5 (polo like kinase 5 (inactive))

Bookmark This Gene