PLGLA (plasminogen like A (pseudogene))
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 285189 |
| Gene name | Plasminogen like A (pseudogene) |
| Gene symbol | PLGLA |
| Synonyms (NCBI Gene) |
PLGLA1PLGP2PRGA
|
| Chromosome | 2 |
| Chromosome location | 2q12.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q15195 | ||||||||||
| Protein name | Plasminogen-like protein A (Plasminogen-like protein A1) (Plasminogen-related protein A) | ||||||||||
| Protein function | May bind non-covalently to lysine binding sites present in the kringle structures of plasminogen. This may interfere with the binding of fibrin or alpha-2-antiplasmin to plasminogen and may result in the localization of activity at sites necessa | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Tissue specificity | TISSUE SPECIFICITY: Expressed in liver. {ECO:0000269|PubMed:10092845}. | ||||||||||
| Sequence |
MEHKEVVLLLLLFLKSGQGEPLDDYVNAQGASLFSVTKKQLGAGSREECAAKCEEDKEFT |
||||||||||
| Sequence length | 96 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with PLGLA across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to PLGLA (see Related Genes above), that are NOT already directly curated for PLGLA itself -- a lead worth checking, not a confirmed association.
0
|
|