PLEKHN1 (pleckstrin homology domain containing N1) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	84069
Gene name	Pleckstrin homology domain containing N1
Gene symbol	PLEKHN1
Synonyms (NCBI Gene)	CLPABP
Chromosome	1
Chromosome location	1p36.33

1

miRTarBase ID	miRNA	Experiments	Reference
MIRT051058	hsa-miR-16-5p	CLASH	23622248

29 Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IBA
GO:0001666	Process	Response to hypoxia	IDA	29531808
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0001786	Function	Phosphatidylserine binding	IDA	18191643
GO:0005515	Function	Protein binding	IPI	18191643, 25416956, 27616329, 29433439, 29531808, 31515488, 32296183, 32814053
GO:0005739	Component	Mitochondrion	IDA	27616329, 29531808
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IDA	18191643
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IBA
GO:0031966	Component	Mitochondrial membrane	IDA	18191643, 29180010
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	29531808
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IBA
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IDA	29180010
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IEA
GO:0070300	Function	Phosphatidic acid binding	IBA
GO:0070300	Function	Phosphatidic acid binding	IDA	18191643
GO:1901612	Function	Cardiolipin binding	IBA
GO:1901612	Function	Cardiolipin binding	IDA	18191643
GO:1901612	Function	Cardiolipin binding	IEA
GO:1901981	Function	Phosphatidylinositol phosphate binding	IBA
GO:1901981	Function	Phosphatidylinositol phosphate binding	IDA	18191643

MIM	HGNC	e!Ensembl
621052	25284	ENSG00000187583

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q494U1
Protein name	Pleckstrin homology domain-containing family N member 1 (PH domain-containing family N member 1) (Cardiolipin and phosphatidic acid-binding protein)
Protein function	Controls the stability of the leptin mRNA harboring an AU-rich element (ARE) in its 3' UTR, in cooperation with the RNA stabilizer ELAVL1 (PubMed:29180010). Decreases the stability of the leptin mRNA by antagonizing the function of ELAVL1 by ind
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Ubiquitous (PubMed:18191643). Epressed in several cancer cell lines of differing origin (PubMed:29531808). {ECO:0000269\|PubMed:18191643, ECO:0000269\|PubMed:29531808}.
Sequence	MGNSHCVPQAPRRLRASFSRKPSLKGNREDSARMSAGLPGPEAARSGDAAANKLFHYIPG TDILDLENQRENLEQPFLSVFKKGRRRVPVRNLGKVVHYAKVQLRFQHSQDVSDCYLELF PAHLYFQAHGSEGLTFQGLLPLTELSVCPLEGSREHAFQITGPLPAPLLVLCPSRAELDR WLYHLEKQTALLGGPRRCHSAPPQRRLTRLRTASGHEPGGSAVCASRVKLQHLPAQEQWD RLLVLYPTSLAIFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCA SYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQVMGSGRGSLSSGGQTSWDSGCLAPPS TRTSHSLPESSVPSTVGCSSQHTPDQANSDRASIGRRRTELRRSGSSRSPGSKARAEGRG PVTPLHLDLTQLHRLSLESSPDAPDHTSETSHSPLYADPYTPPATSHRRVTDVRGLEEFL SAMQSARGPTPSSPLPSVPVSVPASDPRSCSSGPAGPYLLSKKGALQSRAAQRHRGSAKD GGPQPPDAPQLVSSAREGSPEPWLPLTDGRSPRRSRDPGYDHLWDETLSSSHQKCPQLGG PEASGGLVQWI
Sequence length	611
Interactions	View interactions