Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5335
Gene name	Phospholipase C gamma 1
Gene symbol	PLCG1
Synonyms (NCBI Gene)	IDAANCKAP3PLC-IIPLC1PLC148PLCgamma1
Chromosome	20
Chromosome location	20q12
Summary	The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction

283 Show/Hide all (283)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025369	hsa-miR-34a-5p	Proteomics	21566225
MIRT025369	hsa-miR-34a-5p	Proteomics	21566225
MIRT049488	hsa-miR-92a-3p	CLASH	23622248
MIRT037381	hsa-miR-744-3p	CLASH	23622248
MIRT035779	hsa-miR-1914-3p	CLASH	23622248
MIRT654999	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT654998	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT654997	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT654996	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT654995	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT654994	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT654993	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT654992	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT654991	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT654990	hsa-miR-6777-5p	HITS-CLIP	23824327
MIRT501596	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT501595	hsa-miR-429	PAR-CLIP	24398324
MIRT501594	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT501593	hsa-miR-369-3p	PAR-CLIP	24398324
MIRT501592	hsa-miR-5692a	PAR-CLIP	24398324
MIRT501590	hsa-miR-8084	PAR-CLIP	24398324
MIRT501591	hsa-miR-3143	PAR-CLIP	24398324
MIRT501589	hsa-miR-3672	PAR-CLIP	24398324
MIRT501588	hsa-miR-6864-3p	PAR-CLIP	24398324
MIRT501587	hsa-miR-302c-5p	PAR-CLIP	24398324
MIRT501586	hsa-miR-552-5p	PAR-CLIP	24398324
MIRT448578	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT448577	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT448576	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT448575	hsa-miR-302b-5p	PAR-CLIP	22100165
MIRT448574	hsa-miR-302d-5p	PAR-CLIP	22100165
MIRT448573	hsa-miR-4693-3p	PAR-CLIP	22100165
MIRT448572	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT448571	hsa-miR-4635	PAR-CLIP	22100165
MIRT448570	hsa-miR-4795-5p	PAR-CLIP	22100165
MIRT448569	hsa-miR-766-5p	PAR-CLIP	22100165
MIRT448568	hsa-miR-7154-3p	PAR-CLIP	22100165
MIRT448567	hsa-miR-765	PAR-CLIP	22100165
MIRT448565	hsa-miR-6894-5p	PAR-CLIP	22100165
MIRT448566	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT448563	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448564	hsa-miR-573	PAR-CLIP	22100165
MIRT448578	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT448577	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT448576	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT448575	hsa-miR-302b-5p	PAR-CLIP	22100165
MIRT448574	hsa-miR-302d-5p	PAR-CLIP	22100165
MIRT448573	hsa-miR-4693-3p	PAR-CLIP	22100165
MIRT448572	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT448571	hsa-miR-4635	PAR-CLIP	22100165
MIRT448570	hsa-miR-4795-5p	PAR-CLIP	22100165
MIRT448569	hsa-miR-766-5p	PAR-CLIP	22100165
MIRT448568	hsa-miR-7154-3p	PAR-CLIP	22100165
MIRT448567	hsa-miR-765	PAR-CLIP	22100165
MIRT448565	hsa-miR-6894-5p	PAR-CLIP	22100165
MIRT448566	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT448563	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448564	hsa-miR-573	PAR-CLIP	22100165
MIRT448578	hsa-miR-3606-3p	PAR-CLIP	26701625
MIRT448577	hsa-miR-513a-3p	PAR-CLIP	26701625
MIRT448576	hsa-miR-513c-3p	PAR-CLIP	26701625
MIRT654999	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT654998	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT654997	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT654996	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT654995	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT654994	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT654993	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT654992	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT654991	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT654990	hsa-miR-6777-5p	HITS-CLIP	23824327
MIRT501596	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT501595	hsa-miR-429	PAR-CLIP	24398324
MIRT501594	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT501593	hsa-miR-369-3p	PAR-CLIP	24398324
MIRT501592	hsa-miR-5692a	PAR-CLIP	24398324
MIRT501590	hsa-miR-8084	PAR-CLIP	24398324
MIRT501591	hsa-miR-3143	PAR-CLIP	24398324
MIRT501589	hsa-miR-3672	PAR-CLIP	24398324
MIRT501588	hsa-miR-6864-3p	PAR-CLIP	24398324
MIRT501587	hsa-miR-302c-5p	PAR-CLIP	24398324
MIRT501586	hsa-miR-552-5p	PAR-CLIP	24398324
MIRT448578	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT448577	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT448576	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT448575	hsa-miR-302b-5p	PAR-CLIP	22100165
MIRT448574	hsa-miR-302d-5p	PAR-CLIP	22100165
MIRT448573	hsa-miR-4693-3p	PAR-CLIP	22100165
MIRT448572	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT448571	hsa-miR-4635	PAR-CLIP	22100165
MIRT448570	hsa-miR-4795-5p	PAR-CLIP	22100165
MIRT448569	hsa-miR-766-5p	PAR-CLIP	22100165
MIRT448568	hsa-miR-7154-3p	PAR-CLIP	22100165
MIRT448567	hsa-miR-765	PAR-CLIP	22100165
MIRT448565	hsa-miR-6894-5p	PAR-CLIP	22100165
MIRT448566	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT448563	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448564	hsa-miR-573	PAR-CLIP	22100165
MIRT448578	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT448577	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT448576	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT448575	hsa-miR-302b-5p	PAR-CLIP	22100165
MIRT448574	hsa-miR-302d-5p	PAR-CLIP	22100165
MIRT448573	hsa-miR-4693-3p	PAR-CLIP	22100165
MIRT448572	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT448571	hsa-miR-4635	PAR-CLIP	22100165
MIRT448570	hsa-miR-4795-5p	PAR-CLIP	22100165
MIRT448569	hsa-miR-766-5p	PAR-CLIP	22100165
MIRT448568	hsa-miR-7154-3p	PAR-CLIP	22100165
MIRT448567	hsa-miR-765	PAR-CLIP	22100165
MIRT448565	hsa-miR-6894-5p	PAR-CLIP	22100165
MIRT448566	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT448563	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448564	hsa-miR-573	PAR-CLIP	22100165
MIRT1239898	hsa-miR-103a	CLIP-seq
MIRT1239899	hsa-miR-107	CLIP-seq
MIRT1239900	hsa-miR-1184	CLIP-seq
MIRT1239901	hsa-miR-1207-5p	CLIP-seq
MIRT1239902	hsa-miR-1273g	CLIP-seq
MIRT1239903	hsa-miR-129-5p	CLIP-seq
MIRT1239904	hsa-miR-139-3p	CLIP-seq
MIRT1239905	hsa-miR-200b	CLIP-seq
MIRT1239906	hsa-miR-200c	CLIP-seq
MIRT1239907	hsa-miR-205	CLIP-seq
MIRT1239908	hsa-miR-218	CLIP-seq
MIRT1239909	hsa-miR-2392	CLIP-seq
MIRT1239910	hsa-miR-3127-5p	CLIP-seq
MIRT1239911	hsa-miR-3136-3p	CLIP-seq
MIRT1239912	hsa-miR-3150b-3p	CLIP-seq
MIRT1239913	hsa-miR-3152-5p	CLIP-seq
MIRT1239914	hsa-miR-3162-3p	CLIP-seq
MIRT1239915	hsa-miR-3183	CLIP-seq
MIRT1239916	hsa-miR-3202	CLIP-seq
MIRT1239917	hsa-miR-320a	CLIP-seq
MIRT1239918	hsa-miR-320b	CLIP-seq
MIRT1239919	hsa-miR-320c	CLIP-seq
MIRT1239920	hsa-miR-320d	CLIP-seq
MIRT1239921	hsa-miR-338-5p	CLIP-seq
MIRT1239922	hsa-miR-3612	CLIP-seq
MIRT1239923	hsa-miR-3622b-5p	CLIP-seq
MIRT1239924	hsa-miR-3657	CLIP-seq
MIRT1239925	hsa-miR-3909	CLIP-seq
MIRT1239926	hsa-miR-3918	CLIP-seq
MIRT1239927	hsa-miR-3925-3p	CLIP-seq
MIRT1239928	hsa-miR-4253	CLIP-seq
MIRT1239929	hsa-miR-4269	CLIP-seq
MIRT1239930	hsa-miR-4297	CLIP-seq
MIRT1239931	hsa-miR-4426	CLIP-seq
MIRT1239932	hsa-miR-4429	CLIP-seq
MIRT1239933	hsa-miR-4436b-3p	CLIP-seq
MIRT1239934	hsa-miR-4443	CLIP-seq
MIRT1239935	hsa-miR-4446-5p	CLIP-seq
MIRT1239936	hsa-miR-4459	CLIP-seq
MIRT1239937	hsa-miR-4461	CLIP-seq
MIRT1239938	hsa-miR-4487	CLIP-seq
MIRT1239939	hsa-miR-4514	CLIP-seq
MIRT1239940	hsa-miR-4533	CLIP-seq
MIRT1239941	hsa-miR-455-5p	CLIP-seq
MIRT1239942	hsa-miR-4640-5p	CLIP-seq
MIRT1239943	hsa-miR-4647	CLIP-seq
MIRT1239944	hsa-miR-4661-3p	CLIP-seq
MIRT1239945	hsa-miR-4662b	CLIP-seq
MIRT1239946	hsa-miR-4665-3p	CLIP-seq
MIRT1239947	hsa-miR-4669	CLIP-seq
MIRT1239948	hsa-miR-4689	CLIP-seq
MIRT1239949	hsa-miR-4692	CLIP-seq
MIRT1239950	hsa-miR-4710	CLIP-seq
MIRT1239951	hsa-miR-4722-5p	CLIP-seq
MIRT1239952	hsa-miR-4723-3p	CLIP-seq
MIRT1239953	hsa-miR-4726-5p	CLIP-seq
MIRT1239954	hsa-miR-4731-5p	CLIP-seq
MIRT1239955	hsa-miR-4742-5p	CLIP-seq
MIRT1239956	hsa-miR-4755-5p	CLIP-seq
MIRT1239957	hsa-miR-4758-3p	CLIP-seq
MIRT1239958	hsa-miR-4763-3p	CLIP-seq
MIRT1239959	hsa-miR-4774-3p	CLIP-seq
MIRT1239960	hsa-miR-4784	CLIP-seq
MIRT1239961	hsa-miR-4802-5p	CLIP-seq
MIRT1239962	hsa-miR-486-3p	CLIP-seq
MIRT1239963	hsa-miR-515-5p	CLIP-seq
MIRT1239964	hsa-miR-650	CLIP-seq
MIRT1239965	hsa-miR-766	CLIP-seq
MIRT1239966	hsa-miR-938	CLIP-seq
MIRT1239967	hsa-miR-940	CLIP-seq
MIRT1239904	hsa-miR-139-3p	CLIP-seq
MIRT1239912	hsa-miR-3150b-3p	CLIP-seq
MIRT1239921	hsa-miR-338-5p	CLIP-seq
MIRT1239936	hsa-miR-4459	CLIP-seq
MIRT1239937	hsa-miR-4461	CLIP-seq
MIRT1239948	hsa-miR-4689	CLIP-seq
MIRT1239951	hsa-miR-4722-5p	CLIP-seq
MIRT1239960	hsa-miR-4784	CLIP-seq
MIRT1239898	hsa-miR-103a	CLIP-seq
MIRT1239899	hsa-miR-107	CLIP-seq
MIRT2070571	hsa-miR-1179	CLIP-seq
MIRT1239900	hsa-miR-1184	CLIP-seq
MIRT2070572	hsa-miR-1287	CLIP-seq
MIRT1239909	hsa-miR-2392	CLIP-seq
MIRT2070573	hsa-miR-3065-3p	CLIP-seq
MIRT2070574	hsa-miR-3120-5p	CLIP-seq
MIRT2070575	hsa-miR-3135b	CLIP-seq
MIRT2070576	hsa-miR-4420	CLIP-seq
MIRT2070577	hsa-miR-4505	CLIP-seq
MIRT2070578	hsa-miR-4645-5p	CLIP-seq
MIRT2070579	hsa-miR-4652-3p	CLIP-seq
MIRT2070580	hsa-miR-4673	CLIP-seq
MIRT2070581	hsa-miR-4778-3p	CLIP-seq
MIRT2070582	hsa-miR-627	CLIP-seq
MIRT2070583	hsa-miR-924	CLIP-seq
MIRT1239898	hsa-miR-103a	CLIP-seq
MIRT1239899	hsa-miR-107	CLIP-seq
MIRT1239900	hsa-miR-1184	CLIP-seq
MIRT2297667	hsa-miR-1227	CLIP-seq
MIRT2297668	hsa-miR-1289	CLIP-seq
MIRT1239904	hsa-miR-139-3p	CLIP-seq
MIRT2297669	hsa-miR-147	CLIP-seq
MIRT2297670	hsa-miR-1827	CLIP-seq
MIRT2297671	hsa-miR-1914	CLIP-seq
MIRT2297672	hsa-miR-1976	CLIP-seq
MIRT2297673	hsa-miR-199a-3p	CLIP-seq
MIRT2297674	hsa-miR-199b-3p	CLIP-seq
MIRT1239905	hsa-miR-200b	CLIP-seq
MIRT1239906	hsa-miR-200c	CLIP-seq
MIRT2297675	hsa-miR-223	CLIP-seq
MIRT1239909	hsa-miR-2392	CLIP-seq
MIRT2297676	hsa-miR-3064-5p	CLIP-seq
MIRT2297677	hsa-miR-3129-5p	CLIP-seq
MIRT1239911	hsa-miR-3136-3p	CLIP-seq
MIRT2297678	hsa-miR-3189-3p	CLIP-seq
MIRT2297679	hsa-miR-3198	CLIP-seq
MIRT2297680	hsa-miR-331-3p	CLIP-seq
MIRT1239922	hsa-miR-3612	CLIP-seq
MIRT2297681	hsa-miR-3616-3p	CLIP-seq
MIRT1239923	hsa-miR-3622b-5p	CLIP-seq
MIRT1239925	hsa-miR-3909	CLIP-seq
MIRT2297682	hsa-miR-3926	CLIP-seq
MIRT2297683	hsa-miR-4252	CLIP-seq
MIRT1239928	hsa-miR-4253	CLIP-seq
MIRT2297684	hsa-miR-4294	CLIP-seq
MIRT2297685	hsa-miR-4309	CLIP-seq
MIRT2297686	hsa-miR-432	CLIP-seq
MIRT1239933	hsa-miR-4436b-3p	CLIP-seq
MIRT1239934	hsa-miR-4443	CLIP-seq
MIRT2297687	hsa-miR-4448	CLIP-seq
MIRT2297688	hsa-miR-4464	CLIP-seq
MIRT2297689	hsa-miR-4697-3p	CLIP-seq
MIRT1239950	hsa-miR-4710	CLIP-seq
MIRT1239954	hsa-miR-4731-5p	CLIP-seq
MIRT2297690	hsa-miR-4748	CLIP-seq
MIRT2070581	hsa-miR-4778-3p	CLIP-seq
MIRT1239961	hsa-miR-4802-5p	CLIP-seq
MIRT1239962	hsa-miR-486-3p	CLIP-seq
MIRT2297691	hsa-miR-548ac	CLIP-seq
MIRT2297692	hsa-miR-548ae	CLIP-seq
MIRT2297693	hsa-miR-548aj	CLIP-seq
MIRT2297694	hsa-miR-548am	CLIP-seq
MIRT2297695	hsa-miR-548d-3p	CLIP-seq
MIRT2297696	hsa-miR-548p	CLIP-seq
MIRT2297697	hsa-miR-548x	CLIP-seq
MIRT2297698	hsa-miR-548z	CLIP-seq
MIRT2297699	hsa-miR-599	CLIP-seq
MIRT2070582	hsa-miR-627	CLIP-seq
MIRT1239964	hsa-miR-650	CLIP-seq
MIRT2297700	hsa-miR-892b	CLIP-seq
MIRT2297701	hsa-miR-922	CLIP-seq
MIRT2070583	hsa-miR-924	CLIP-seq
MIRT2297702	hsa-miR-936	CLIP-seq
MIRT1239912	hsa-miR-3150b-3p	CLIP-seq
MIRT1239914	hsa-miR-3162-3p	CLIP-seq
MIRT1239915	hsa-miR-3183	CLIP-seq
MIRT1239921	hsa-miR-338-5p	CLIP-seq
MIRT2297683	hsa-miR-4252	CLIP-seq
MIRT2595176	hsa-miR-4279	CLIP-seq
MIRT1239935	hsa-miR-4446-5p	CLIP-seq
MIRT1239936	hsa-miR-4459	CLIP-seq
MIRT2595177	hsa-miR-4639-3p	CLIP-seq
MIRT1239948	hsa-miR-4689	CLIP-seq
MIRT1239950	hsa-miR-4710	CLIP-seq
MIRT1239951	hsa-miR-4722-5p	CLIP-seq
MIRT1239952	hsa-miR-4723-3p	CLIP-seq
MIRT1239956	hsa-miR-4755-5p	CLIP-seq
MIRT1239960	hsa-miR-4784	CLIP-seq
MIRT1239963	hsa-miR-515-5p	CLIP-seq

63 Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IDA	17229814
GO:0001726	Component	Ruffle	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IBA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IDA	2550068
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IEA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	TAS
GO:0004629	Function	Phospholipase C activity	IDA	20510673
GO:0004629	Function	Phospholipase C activity	IMP	37422272
GO:0004629	Function	Phospholipase C activity	TAS
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	ISS
GO:0005168	Function	Neurotrophin TRKA receptor binding	IPI	15488758
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	1396585, 1656221, 7537096, 7537265, 7693694, 7993895, 8321198, 8384556, 8627166, 8657103, 8892607, 9020117, 9045636, 9489702, 9593725, 9697839, 10811803, 10873601, 11796522, 11896612, 14568990, 14570588, 14722116, 15641795, 15929943, 16273093, 16525023, 16921170, 16938345, 17229814, 1
GO:0005737	Component	Cytoplasm	IDA	15702972
GO:0005829	Component	Cytosol	IDA	2550068
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	20510673
GO:0005886	Component	Plasma membrane	IDA	2550068, 22454520
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	22454520
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	ISS
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0008180	Component	COP9 signalosome	IDA	22561606
GO:0009395	Process	Phospholipid catabolic process	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IBA
GO:0010634	Process	Positive regulation of epithelial cell migration	IMP	17229814
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016477	Process	Cell migration	IMP	22454520
GO:0016787	Function	Hydrolase activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019722	Process	Calcium-mediated signaling	IMP	22454520
GO:0019901	Function	Protein kinase binding	IPI	22454520
GO:0030027	Component	Lamellipodium	IDA	17229814
GO:0030027	Component	Lamellipodium	IEA
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IDA	11331309
GO:0032587	Component	Ruffle membrane	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042995	Component	Cell projection	IDA	22454520
GO:0042995	Component	Cell projection	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	20011604
GO:0045766	Process	Positive regulation of angiogenesis	IDA	20011604
GO:0046488	Process	Phosphatidylinositol metabolic process	IBA
GO:0046488	Process	Phosphatidylinositol metabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048015	Process	Phosphatidylinositol-mediated signaling	IBA
GO:0050429	Function	Calcium-dependent phospholipase C activity	ISS
GO:0050851	Process	Antigen receptor-mediated signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IMP	22454520
GO:0051282	Process	Regulation of sequestering of calcium ion	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	17229814
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IMP	22454520
GO:0120548	Function	Phosphatidylinositol phospholipase C activity	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IMP	27464494
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	27464494

MIM	HGNC	e!Ensembl
172420	9065	ENSG00000124181

P19174

Protein name

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 (EC 3.1.4.11) (PLC-148) (Phosphoinositide phospholipase C-gamma-1) (Phospholipase C-II) (PLC-II) (Phospholipase C-gamma-1) (PLC-gamma-1)

Protein function

Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediate

PDB

1HSQ , 2HSP , 4EY0 , 4FBN , 7NXE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	550 → 639	SH2 domain	Domain
PF00017	SH2	668 → 741	SH2 domain	Domain
PF00018	SH3_1	797 → 843	SH3 domain	Domain
PF00168	C2	1088 → 1193	C2 domain	Domain
PF00387	PI-PLC-Y	953 → 1068	Phosphatidylinositol-specific phospholipase C, Y domain	Family
PF00388	PI-PLC-X	322 → 465	Phosphatidylinositol-specific phospholipase C, X domain	Family

Sequence

MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL

Sequence length

1290

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Inositol phosphate metabolism	ISG15 antiviral mechanism
Metabolic pathways	Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
EGFR tyrosine kinase inhibitor resistance	Synthesis of IP3 and IP4 in the cytosol
ErbB signaling pathway	Downstream signal transduction
Ras signaling pathway	Generation of second messenger molecules
Rap1 signaling pathway	Role of phospholipids in phagocytosis
Calcium signaling pathway	PECAM1 interactions
Chemokine signaling pathway	EGFR interacts with phospholipase C-gamma
NF-kappa B signaling pathway	DAP12 signaling
HIF-1 signaling pathway	FCERI mediated MAPK activation
Phosphatidylinositol signaling system	FCERI mediated Ca+2 mobilization
Phospholipase D signaling pathway	VEGFR2 mediated cell proliferation
Axon guidance	Constitutive Signaling by EGFRvIII
VEGF signaling pathway	Phospholipase C-mediated cascade: FGFR1
Neutrophil extracellular trap formation	Phospholipase C-mediated cascade; FGFR2
Natural killer cell mediated cytotoxicity	Phospholipase C-mediated cascade; FGFR3
Th1 and Th2 cell differentiation	Phospholipase C-mediated cascade; FGFR4
Th17 cell differentiation	Signaling by FGFR2 in disease
T cell receptor signaling pathway	Signaling by FGFR4 in disease
Fc epsilon RI signaling pathway	Signaling by FGFR1 in disease
Fc gamma R-mediated phagocytosis	Signaling by FGFR3 point mutants in cancer
Leukocyte transendothelial migration	RET signaling
Neurotrophin signaling pathway	Activated NTRK2 signals through PLCG1
Inflammatory mediator regulation of TRP channels	Activated NTRK3 signals through PLCG1
Thyroid hormone signaling pathway	FCGR3A-mediated IL10 synthesis
AGE-RAGE signaling pathway in diabetic complications	Signaling by ERBB2 KD Mutants
Growth hormone synthesis, secretion and action	Signaling by ERBB2 ECD mutants
Parkinson disease	Signaling by ERBB2 TMD/JMD mutants
Pathways of neurodegeneration - multiple diseases
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Yersinia infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Hepatocellular carcinoma
Choline metabolism in cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immune dysregulation, autoimmunity, and autoinflammation	Pathogenic	rs2515585150	RCV003330117	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (14)
ATRIAL FIBRILLATION	—	GWAS catalog	27790247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	27790247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	27790247, 29212778	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	27790247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	27790247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMANGIOSARCOMA	—	CTD	24633157	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	26437031	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	27479909	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	38072966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLCG1-related disorder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEZARY SYNDROME	—	CTD	26551670	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	27790247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (124)
Achondroplasia, Severe, With Developmental Delay And Acanthosis Nigricans	SADDAN dysplasia	BEFREE	29242050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28978037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25308733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	26437031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	29794791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	27369867, 30814910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25993291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37008939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28063403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	9083089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	11409699		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11409699		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Platelet Disorders	Platelet disorder	Pubtator	31889510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	31150948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19074886, 20514023, 22847294, 28829192, 31362705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14710234, 23320987, 28112359, 31323325, 31362705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	31150948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29049217, 31049933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	8275435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26290635, 35242200, 35535333, 36920176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26518718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24740199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24576174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20510673, 20621058, 26464646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24740199, 31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	22022282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29464031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19672874, 29066806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17531112, 27562229, 29464031, 7608208, 8275435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15996687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27562229, 29693170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26247939, 29435116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Irritant	Dermatitis	BEFREE	31338881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	37460827	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	1639386, 37538791, 38034011, 8094595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	1639386, 9285775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	31338881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	37873683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26481038, 29247482, 30287524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24740199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	21471003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	30503263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25308733, 26811493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21649900, 25943352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25943352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25943352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20506511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20506511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Slack Skin	Granulomatous Slack Skin	CTD_human_DG	26192916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37989267	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	36181115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	24633157, 24795022, 25252913, 26440310, 29190660		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	24633157		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	Pubtator	24633157, 26440310, 26474454	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	CGI_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	BEFREE	28541476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29388468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	25307426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31548507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29950425		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17419608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	7828717	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19114693, 28978037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29066806, 30623526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	26375550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37426642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25308733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26464646	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	24497536, 26269406, 29794791, 31049933, 31376383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	CTD_human_DG	26192916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	12766168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	27479909		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	19074886, 20514023, 22847294, 28829192, 31362705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26518718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19923922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22454520, 25308733, 28574619, 29464031, 29972810, 31548507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19672874, 29066806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28112359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	1639386, 8094595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22022282, 27827461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22022282, 27827461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	19805378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23469041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	29794791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19114693, 19805378, 22596089, 31755660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	31755660	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	32323808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18037957, 19074886, 21242968, 22869928, 24899266, 26269406, 26811493, 27121473, 28574619, 29721385, 30623526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23931760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22022282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25073093, 26247939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27789216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37335694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26096802		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31298409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29049217, 35677632, 35682857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35844512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18037957, 19923922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37194062	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	22984568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31086815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36250055	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29937272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	1639386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	26269406, 26551670, 27121473	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary Syndrome	CTD_human_DG	26551670		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary Syndrome	BEFREE	27121473, 31376383		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	22349826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18594017, 20395290, 26464646, 33466212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25308733, 27039174, 32679742, 37863665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	31338881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	26398624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	35003060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	12766168		★★★★★ ★☆☆☆☆ Found in Text Mining only

PLCG1 (phospholipase C gamma 1)

Save This Analysis