PLAC9 (placenta associated 9)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 219348
• Gene name: Placenta associated 9
• Gene symbol: PLAC9
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10q22.3

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1239017	hsa-miR-3665	CLIP-seq
MIRT1239018	hsa-miR-4736	CLIP-seq
MIRT1239019	hsa-miR-764	CLIP-seq
MIRT1239020	hsa-miR-767-5p	CLIP-seq
MIRT1239017	hsa-miR-3665	CLIP-seq
MIRT1239018	hsa-miR-4736	CLIP-seq
MIRT1239019	hsa-miR-764	CLIP-seq
MIRT1239020	hsa-miR-767-5p	CLIP-seq
MIRT2594934	hsa-miR-378g	CLIP-seq
MIRT2594935	hsa-miR-4267	CLIP-seq
MIRT2594936	hsa-miR-4437	CLIP-seq
MIRT2594937	hsa-miR-4674	CLIP-seq
MIRT2594938	hsa-miR-4685-5p	CLIP-seq
MIRT2594939	hsa-miR-4731-5p	CLIP-seq
MIRT2594940	hsa-miR-766	CLIP-seq
MIRT2594934	hsa-miR-378g	CLIP-seq
MIRT2594935	hsa-miR-4267	CLIP-seq
MIRT2594936	hsa-miR-4437	CLIP-seq
MIRT2594937	hsa-miR-4674	CLIP-seq
MIRT2594938	hsa-miR-4685-5p	CLIP-seq
MIRT2594939	hsa-miR-4731-5p	CLIP-seq
MIRT2594940	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IEA

Other IDs

• MIM: 612857
• HGNC: 19255
• e!Ensembl: ENSG00000189129

Protein

• UniProt ID: Q5JTB6
• Protein name: Placenta-specific protein 9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15205	PLAC9	23 → 96	Placenta-specific protein 9	Family

• Sequence:

  MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTV
  DHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

• Sequence length: 97

Related Genes

No strongly related genes found yet for PLAC9.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PLAC9.