PLAAT5 (phospholipase A and acyltransferase 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 117245
• Gene name: Phospholipase A and acyltransferase 5
• Gene symbol: PLAAT5
• Synonyms (NCBI Gene): HRASLS5, HRLP5, HRSL5, PLAAT-5, RLP1, iNAT
• Chromosome: 11
• Chromosome location: 11q12.3

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004623	Function	Phospholipase A2 activity	IBA
GO:0004623	Function	Phospholipase A2 activity	IDA	22825852
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0008970	Function	Phospholipase A1 activity	IDA	22825852
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0016410	Function	N-acyltransferase activity	IBA
GO:0016410	Function	N-acyltransferase activity	IDA	19000777, 22825852
GO:0016410	Function	N-acyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IBA
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IDA	19000777
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IDA	22825852
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IEA
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IEA

Other IDs

• MIM: 611474
• HGNC: 24978
• e!Ensembl: ENSG00000168004

Protein

• UniProt ID: Q96KN8
• Protein name: Phospholipase A and acyltransferase 5 (Ca(2+)-independent N-acyltransferase) (iNAT) (EC 2.3.1.-, EC 3.1.1.32, EC 3.1.1.4) (H-rev107-like protein 5) (HRAS-like suppressor 5) (HRSL5)
• Protein function: Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:22825852, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04970	LRAT	128 → 246	Lecithin retinol acyltransferase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest expression level in testis and pancreas.
• Sequence:

  MGLSPGAEGEYALRLPRIPPPLPKPASRTASTGPKDQPPALRRSAVPHSGLNSISPLELE
  ESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLI
  KQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVV
  KYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGL
  RYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA

• Sequence length: 279

Pathways

Reactome Pathway:

Acyl chain remodelling of PE

Related Genes

No strongly related genes found yet for PLAAT5.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PLAAT5.