PLAAT1 (phospholipase A and acyltransferase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57110
• Gene name: Phospholipase A and acyltransferase 1
• Gene symbol: PLAAT1
• Synonyms (NCBI Gene): A-C1, H-REV107, HRASLS, HRASLS1, HRSL1, HSD28, PLA/AT1, PLAAT-1
• Chromosome: 3
• Chromosome location: 3q29

Gene ontology (GO) Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004620	Function	Phospholipase activity	IEA
GO:0004623	Function	Phospholipase A2 activity	IBA
GO:0004623	Function	Phospholipase A2 activity	IDA	21880860, 22825852, 27623847
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	27623847
GO:0005634	Component	Nucleus	IEA
GO:0005641	Component	Nuclear envelope lumen	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	27623847
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	ISS
GO:0005764	Component	Lysosome	ISS
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005829	Component	Cytosol	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008374	Function	O-acyltransferase activity	IDA	21880860
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0008970	Function	Phospholipase A1 activity	IDA	21880860, 22825852, 27623847
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016410	Function	N-acyltransferase activity	IBA
GO:0016410	Function	N-acyltransferase activity	IDA	21880860, 22825852, 27623847
GO:0016410	Function	N-acyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046470	Process	Phosphatidylcholine metabolic process	IDA	21880860
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IBA
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IDA	22825852, 27623847
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IEA
GO:0070306	Process	Lens fiber cell differentiation	ISS
GO:1903008	Process	Organelle disassembly	ISS

Other IDs

• MIM: 606487
• HGNC: 14922
• e!Ensembl: ENSG00000127252

Protein

• UniProt ID: Q9HDD0
• Protein name: Phospholipase A and acyltransferase 1 (EC 2.3.1.-) (EC 3.1.1.32) (EC 3.1.1.4) (HRAS-like suppressor 1) (HRSL1) (Phospholipid-metabolizing enzyme A-C1)
• Protein function: Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:21880860, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04970	LRAT	14 → 132	Lecithin retinol acyltransferase	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Abundantly expressed in testis, skeletal muscle, brain, and heart. {ECO:0000269|PubMed:21880860}.; TISSUE SPECIFICITY: [Isoform 2]: Highly expressed in the testis, skeletal muscle, brain, heart, and thyroid. {ECO:0000269|P
• Sequence:

  MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVF
  SSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCE
  HFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY

• Sequence length: 168

Pathways

Reactome Pathway:

Acyl chain remodelling of PE

Related Genes

No strongly related genes found yet for PLAAT1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PLAAT1.