PKN3 (protein kinase N3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 29941
• Gene name: Protein kinase N3
• Gene symbol: PKN3
• Synonyms (NCBI Gene): UTDP4-1
• Chromosome: 9
• Chromosome location: 9q34.11

miRNA Show/Hide all (65)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016540	hsa-miR-193b-3p	Microarray	20304954
MIRT042972	hsa-miR-324-3p	CLASH	23622248
MIRT039934	hsa-miR-615-3p	CLASH	23622248
MIRT036498	hsa-miR-1226-3p	CLASH	23622248
MIRT1237848	hsa-miR-1207-5p	CLIP-seq
MIRT1237849	hsa-miR-1275	CLIP-seq
MIRT1237850	hsa-miR-132	CLIP-seq
MIRT1237851	hsa-miR-142-5p	CLIP-seq
MIRT1237852	hsa-miR-212	CLIP-seq
MIRT1237853	hsa-miR-2467-3p	CLIP-seq
MIRT1237854	hsa-miR-2467-5p	CLIP-seq
MIRT1237855	hsa-miR-3151	CLIP-seq
MIRT1237856	hsa-miR-3179	CLIP-seq
MIRT1237857	hsa-miR-3202	CLIP-seq
MIRT1237858	hsa-miR-340	CLIP-seq
MIRT1237859	hsa-miR-4271	CLIP-seq
MIRT1237860	hsa-miR-4422	CLIP-seq
MIRT1237861	hsa-miR-4447	CLIP-seq
MIRT1237862	hsa-miR-4468	CLIP-seq
MIRT1237863	hsa-miR-4472	CLIP-seq
MIRT1237864	hsa-miR-4475	CLIP-seq
MIRT1237865	hsa-miR-4514	CLIP-seq
MIRT1237866	hsa-miR-4525	CLIP-seq
MIRT1237867	hsa-miR-4645-5p	CLIP-seq
MIRT1237868	hsa-miR-4665-5p	CLIP-seq
MIRT1237869	hsa-miR-4673	CLIP-seq
MIRT1237870	hsa-miR-4692	CLIP-seq
MIRT1237871	hsa-miR-4723-5p	CLIP-seq
MIRT1237872	hsa-miR-4725-3p	CLIP-seq
MIRT1237873	hsa-miR-4747-5p	CLIP-seq
MIRT1237874	hsa-miR-4763-3p	CLIP-seq
MIRT1237875	hsa-miR-491-5p	CLIP-seq
MIRT1237876	hsa-miR-603	CLIP-seq
MIRT1237877	hsa-miR-622	CLIP-seq
MIRT1237878	hsa-miR-625	CLIP-seq
MIRT1237879	hsa-miR-889	CLIP-seq
MIRT1237880	hsa-miR-940	CLIP-seq
MIRT1237849	hsa-miR-1275	CLIP-seq
MIRT2069943	hsa-miR-1285	CLIP-seq
MIRT1237850	hsa-miR-132	CLIP-seq
MIRT1237852	hsa-miR-212	CLIP-seq
MIRT2069944	hsa-miR-3117-5p	CLIP-seq
MIRT1237855	hsa-miR-3151	CLIP-seq
MIRT1237856	hsa-miR-3179	CLIP-seq
MIRT2069945	hsa-miR-3187-5p	CLIP-seq
MIRT1237857	hsa-miR-3202	CLIP-seq
MIRT2069946	hsa-miR-378g	CLIP-seq
MIRT2069947	hsa-miR-4257	CLIP-seq
MIRT1237859	hsa-miR-4271	CLIP-seq
MIRT1237861	hsa-miR-4447	CLIP-seq
MIRT1237863	hsa-miR-4472	CLIP-seq
MIRT2069948	hsa-miR-4486	CLIP-seq
MIRT1237866	hsa-miR-4525	CLIP-seq
MIRT2069949	hsa-miR-4640-5p	CLIP-seq
MIRT1237868	hsa-miR-4665-5p	CLIP-seq
MIRT1237871	hsa-miR-4723-5p	CLIP-seq
MIRT1237872	hsa-miR-4725-3p	CLIP-seq
MIRT2069950	hsa-miR-4726-5p	CLIP-seq
MIRT1237873	hsa-miR-4747-5p	CLIP-seq
MIRT2069951	hsa-miR-4755-3p	CLIP-seq
MIRT1237875	hsa-miR-491-5p	CLIP-seq
MIRT2069952	hsa-miR-612	CLIP-seq
MIRT1237877	hsa-miR-622	CLIP-seq
MIRT1237878	hsa-miR-625	CLIP-seq
MIRT2069953	hsa-miR-720	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10441506
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11432776, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10441506
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	TAS	10441506
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	TAS	10441506
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10441506
GO:0010631	Process	Epithelial cell migration	IDA	21754995
GO:0010631	Process	Epithelial cell migration	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 610714
• HGNC: 17999
• e!Ensembl: ENSG00000160447

Protein

• UniProt ID: Q6P5Z2
• Protein name: Serine/threonine-protein kinase N3 (EC 2.7.11.13) (Protein kinase PKN-beta) (Protein-kinase C-related kinase 3)
• Protein function: Contributes to invasiveness in malignant prostate cancer.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00433	Pkinase_C	841 → 881	Protein kinase C terminal domain	Family
  PF02185	HR1	180 → 246	Hr1 repeat	Family
  PF02185	HR1	106 → 173	Hr1 repeat	Family
  PF02185	HR1	20 → 80	Hr1 repeat	Family
  PF00069	Pkinase	559 → 818	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in prostate tumors and various cancer cell lines. Not expressed in adult tissues. {ECO:0000269|PubMed:10441506}.
• Sequence:

  MEEGAPRQPGPSQWPPEDEKEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSS
  NRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEALRRQLHVELKV
  KQGAENMTHTCASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLA
  EELQHRLHVEAAVAEGAKNVVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLL
  EQLPPAHPLRSRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGRSP
  AAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVI
  PLERARELEIGVHWRDWRQLCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVI
  ERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPSTISPPKGCPRT
  PTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQEPTSEETPRTKRPHMEPRTR
  RGPSPPASPTRKPPRLQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDE
  IESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQIHEDVFPEPQ
  ARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFC
  GTPEFLAPEVLTQEAYTRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPG
  FLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQPPFVPTLC
  GPADLRYFEGEFTGLPPALTPPAPHSLLTARQQAAFRDFDFVSERFLEP

• Sequence length: 889

Pathways

KEGG Pathway:

PI3K-Akt signaling pathway

Reactome Pathway:

RHO GTPases activate PKNs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATOPIC ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	39067062, 41238958	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (10)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	32525932	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28851822		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30422386		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32525932	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32525932	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30422386		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19047158, 26742562, 30422386		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15282551, 21754995, 29098022, 30024300		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28851822		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28851822		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PKN3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PKN3.