PIRT (phosphoinositide interacting regulator of transient receptor potential channels)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 644139
• Gene name: Phosphoinositide interacting regulator of transient receptor potential channels
• Gene symbol: PIRT
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17p12

miRNA Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1236107	hsa-miR-134	CLIP-seq
MIRT1236108	hsa-miR-1343	CLIP-seq
MIRT1236109	hsa-miR-136	CLIP-seq
MIRT1236110	hsa-miR-1470	CLIP-seq
MIRT1236111	hsa-miR-193a-5p	CLIP-seq
MIRT1236112	hsa-miR-3074-5p	CLIP-seq
MIRT1236113	hsa-miR-3118	CLIP-seq
MIRT1236114	hsa-miR-3154	CLIP-seq
MIRT1236115	hsa-miR-3157-5p	CLIP-seq
MIRT1236116	hsa-miR-3185	CLIP-seq
MIRT1236117	hsa-miR-3622b-5p	CLIP-seq
MIRT1236118	hsa-miR-3670	CLIP-seq
MIRT1236119	hsa-miR-3673	CLIP-seq
MIRT1236120	hsa-miR-3690	CLIP-seq
MIRT1236121	hsa-miR-3976	CLIP-seq
MIRT1236122	hsa-miR-4254	CLIP-seq
MIRT1236123	hsa-miR-4330	CLIP-seq
MIRT1236124	hsa-miR-4493	CLIP-seq
MIRT1236125	hsa-miR-4646-5p	CLIP-seq
MIRT1236126	hsa-miR-4667-3p	CLIP-seq
MIRT1236127	hsa-miR-4691-3p	CLIP-seq
MIRT1236128	hsa-miR-4704-3p	CLIP-seq
MIRT1236129	hsa-miR-4711-5p	CLIP-seq
MIRT1236130	hsa-miR-4717-5p	CLIP-seq
MIRT1236131	hsa-miR-4720-5p	CLIP-seq
MIRT1236132	hsa-miR-4747-5p	CLIP-seq
MIRT1236133	hsa-miR-4753-5p	CLIP-seq
MIRT1236134	hsa-miR-4799-3p	CLIP-seq
MIRT1236135	hsa-miR-873	CLIP-seq
MIRT2069472	hsa-miR-4709-3p	CLIP-seq
MIRT1236132	hsa-miR-4747-5p	CLIP-seq
MIRT2296814	hsa-miR-25	CLIP-seq
MIRT2296815	hsa-miR-32	CLIP-seq
MIRT2296816	hsa-miR-33a	CLIP-seq
MIRT2296817	hsa-miR-33b	CLIP-seq
MIRT2296818	hsa-miR-3614-5p	CLIP-seq
MIRT2296819	hsa-miR-363	CLIP-seq
MIRT2296820	hsa-miR-367	CLIP-seq
MIRT2296821	hsa-miR-4325	CLIP-seq
MIRT2296822	hsa-miR-92a	CLIP-seq
MIRT2296823	hsa-miR-92b	CLIP-seq
MIRT2456529	hsa-miR-1289	CLIP-seq
MIRT2456530	hsa-miR-298	CLIP-seq
MIRT2456531	hsa-miR-3198	CLIP-seq
MIRT2456532	hsa-miR-3678-3p	CLIP-seq
MIRT2456533	hsa-miR-4294	CLIP-seq
MIRT2456534	hsa-miR-4309	CLIP-seq
MIRT2456535	hsa-miR-4491	CLIP-seq
MIRT2456536	hsa-miR-4657	CLIP-seq
MIRT2456537	hsa-miR-4684-3p	CLIP-seq
MIRT2456529	hsa-miR-1289	CLIP-seq
MIRT2456530	hsa-miR-298	CLIP-seq
MIRT2456531	hsa-miR-3198	CLIP-seq
MIRT2456532	hsa-miR-3678-3p	CLIP-seq
MIRT2456533	hsa-miR-4294	CLIP-seq
MIRT2456534	hsa-miR-4309	CLIP-seq
MIRT2456535	hsa-miR-4491	CLIP-seq
MIRT2456536	hsa-miR-4657	CLIP-seq
MIRT2456537	hsa-miR-4684-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0009408	Process	Response to heat	IEA
GO:0016020	Component	Membrane	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0048266	Process	Behavioral response to pain	IEA
GO:0051930	Process	Regulation of sensory perception of pain	IBA
GO:1902936	Function	Phosphatidylinositol bisphosphate binding	IBA
GO:1902936	Function	Phosphatidylinositol bisphosphate binding	IEA

Other IDs

• MIM: 612068
• HGNC: 37239
• e!Ensembl: ENSG00000233670

Protein

• UniProt ID: P0C851
• Protein name: Phosphoinositide-interacting protein
• Protein function: Regulatory subunit of TRPV1, a molecular sensor of noxious heat and capsaicin. Positively regulates TRPV1 channel activity via phosphatidylinositol 4,5-bisphosphate (PIP2). Binds various phosphoinositide, including phosphatidylinositol 4,5-bisph
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15099	PIRT	7 → 137	Phosphoinositide-interacting protein family	Family

• Sequence:

  MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMS
  VGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKH
  RQKSNFLRSLKSFFLTR

• Sequence length: 137

Related Genes

No strongly related genes found yet for PIRT.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PIRT.