PIM2 (Pim-2 proto-oncogene, serine/threonine kinase)

Gene

• Entrez ID: 11040
• Gene name: Pim-2 proto-oncogene, serine/threonine kinase
• Gene symbol: PIM2
• Synonyms (NCBI Gene): -
• Chromosome: X
• Chromosome location: Xp11.23
• Summary: This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.[provided by RefSeq, Nov 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030307	hsa-miR-26b-5p	Microarray	19088304
MIRT030617	hsa-miR-24-3p	Sequencing	20371350
MIRT036440	hsa-miR-1226-3p	CLASH	23622248
MIRT471073	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT471072	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT471071	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT471070	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT471069	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT471068	hsa-miR-940	PAR-CLIP	23592263
MIRT471067	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT471065	hsa-miR-4514	PAR-CLIP	23592263
MIRT471066	hsa-miR-4692	PAR-CLIP	23592263
MIRT471064	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT471063	hsa-miR-4673	PAR-CLIP	23592263
MIRT471062	hsa-miR-1253	PAR-CLIP	23592263
MIRT471061	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT471060	hsa-miR-8064	PAR-CLIP	23592263
MIRT471059	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT471058	hsa-miR-4434	PAR-CLIP	23592263
MIRT471056	hsa-miR-4516	PAR-CLIP	23592263
MIRT471057	hsa-miR-5703	PAR-CLIP	23592263
MIRT471073	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT471072	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT471071	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT471070	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT471069	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT471068	hsa-miR-940	PAR-CLIP	23592263
MIRT471067	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT471065	hsa-miR-4514	PAR-CLIP	23592263
MIRT471066	hsa-miR-4692	PAR-CLIP	23592263
MIRT471064	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT471063	hsa-miR-4673	PAR-CLIP	23592263
MIRT471062	hsa-miR-1253	PAR-CLIP	23592263
MIRT471061	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT471060	hsa-miR-8064	PAR-CLIP	23592263
MIRT471059	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT471058	hsa-miR-4434	PAR-CLIP	23592263
MIRT471056	hsa-miR-4516	PAR-CLIP	23592263
MIRT471057	hsa-miR-5703	PAR-CLIP	23592263
MIRT1235168	hsa-miR-1182	CLIP-seq
MIRT1235169	hsa-miR-1226	CLIP-seq
MIRT1235170	hsa-miR-1243	CLIP-seq
MIRT1235171	hsa-miR-1292	CLIP-seq
MIRT1235172	hsa-miR-188-5p	CLIP-seq
MIRT1235173	hsa-miR-197	CLIP-seq
MIRT1235174	hsa-miR-200b	CLIP-seq
MIRT1235175	hsa-miR-200c	CLIP-seq
MIRT1235176	hsa-miR-2276	CLIP-seq
MIRT1235177	hsa-miR-24	CLIP-seq
MIRT1235178	hsa-miR-3614-5p	CLIP-seq
MIRT1235179	hsa-miR-3654	CLIP-seq
MIRT1235180	hsa-miR-3664-3p	CLIP-seq
MIRT1235181	hsa-miR-378	CLIP-seq
MIRT1235182	hsa-miR-378b	CLIP-seq
MIRT1235183	hsa-miR-378c	CLIP-seq
MIRT1235184	hsa-miR-378d	CLIP-seq
MIRT1235185	hsa-miR-378e	CLIP-seq
MIRT1235186	hsa-miR-378f	CLIP-seq
MIRT1235187	hsa-miR-378h	CLIP-seq
MIRT1235188	hsa-miR-378i	CLIP-seq
MIRT1235189	hsa-miR-412	CLIP-seq
MIRT1235190	hsa-miR-422a	CLIP-seq
MIRT1235191	hsa-miR-4283	CLIP-seq
MIRT1235192	hsa-miR-429	CLIP-seq
MIRT1235193	hsa-miR-4433	CLIP-seq
MIRT1235194	hsa-miR-4437	CLIP-seq
MIRT1235195	hsa-miR-4449	CLIP-seq
MIRT1235196	hsa-miR-4459	CLIP-seq
MIRT1235197	hsa-miR-4471	CLIP-seq
MIRT1235198	hsa-miR-4490	CLIP-seq
MIRT1235199	hsa-miR-4508	CLIP-seq
MIRT1235200	hsa-miR-450b-3p	CLIP-seq
MIRT1235201	hsa-miR-4520a-3p	CLIP-seq
MIRT1235202	hsa-miR-4520b-3p	CLIP-seq
MIRT1235203	hsa-miR-4532	CLIP-seq
MIRT1235204	hsa-miR-4684-3p	CLIP-seq
MIRT1235205	hsa-miR-4696	CLIP-seq
MIRT1235206	hsa-miR-4724-3p	CLIP-seq
MIRT1235207	hsa-miR-4733-3p	CLIP-seq
MIRT1235208	hsa-miR-4772-3p	CLIP-seq
MIRT1235209	hsa-miR-4797-5p	CLIP-seq
MIRT1235210	hsa-miR-765	CLIP-seq
MIRT1235211	hsa-miR-769-3p	CLIP-seq
MIRT2069234	hsa-miR-3065-5p	CLIP-seq
MIRT2069235	hsa-miR-3121-5p	CLIP-seq
MIRT2069236	hsa-miR-3159	CLIP-seq
MIRT2069237	hsa-miR-3192	CLIP-seq
MIRT2069238	hsa-miR-3674	CLIP-seq
MIRT2069239	hsa-miR-3689a-3p	CLIP-seq
MIRT2069240	hsa-miR-3689c	CLIP-seq
MIRT2069241	hsa-miR-4314	CLIP-seq
MIRT2069242	hsa-miR-4448	CLIP-seq
MIRT2069243	hsa-miR-4476	CLIP-seq
MIRT2069244	hsa-miR-4646-5p	CLIP-seq
MIRT2069245	hsa-miR-4728-5p	CLIP-seq
MIRT2069246	hsa-miR-505	CLIP-seq
MIRT2069247	hsa-miR-654-3p	CLIP-seq
MIRT1235170	hsa-miR-1243	CLIP-seq
MIRT1235171	hsa-miR-1292	CLIP-seq
MIRT2296314	hsa-miR-1343	CLIP-seq
MIRT2296315	hsa-miR-140-3p	CLIP-seq
MIRT2296316	hsa-miR-1587	CLIP-seq
MIRT2296317	hsa-miR-1827	CLIP-seq
MIRT1235172	hsa-miR-188-5p	CLIP-seq
MIRT1235173	hsa-miR-197	CLIP-seq
MIRT1235174	hsa-miR-200b	CLIP-seq
MIRT1235175	hsa-miR-200c	CLIP-seq
MIRT1235177	hsa-miR-24	CLIP-seq
MIRT2069235	hsa-miR-3121-5p	CLIP-seq
MIRT2069236	hsa-miR-3159	CLIP-seq
MIRT2069237	hsa-miR-3192	CLIP-seq
MIRT1235178	hsa-miR-3614-5p	CLIP-seq
MIRT1235179	hsa-miR-3654	CLIP-seq
MIRT2069238	hsa-miR-3674	CLIP-seq
MIRT2069239	hsa-miR-3689a-3p	CLIP-seq
MIRT2069240	hsa-miR-3689c	CLIP-seq
MIRT1235181	hsa-miR-378	CLIP-seq
MIRT1235182	hsa-miR-378b	CLIP-seq
MIRT1235183	hsa-miR-378c	CLIP-seq
MIRT1235184	hsa-miR-378d	CLIP-seq
MIRT1235185	hsa-miR-378e	CLIP-seq
MIRT1235186	hsa-miR-378f	CLIP-seq
MIRT2296318	hsa-miR-378g	CLIP-seq
MIRT1235187	hsa-miR-378h	CLIP-seq
MIRT1235188	hsa-miR-378i	CLIP-seq
MIRT1235189	hsa-miR-412	CLIP-seq
MIRT1235190	hsa-miR-422a	CLIP-seq
MIRT1235192	hsa-miR-429	CLIP-seq
MIRT2069241	hsa-miR-4314	CLIP-seq
MIRT2069242	hsa-miR-4448	CLIP-seq
MIRT1235197	hsa-miR-4471	CLIP-seq
MIRT2069243	hsa-miR-4476	CLIP-seq
MIRT1235198	hsa-miR-4490	CLIP-seq
MIRT2296319	hsa-miR-4492	CLIP-seq
MIRT2296320	hsa-miR-4498	CLIP-seq
MIRT2069244	hsa-miR-4646-5p	CLIP-seq
MIRT2296321	hsa-miR-4649-3p	CLIP-seq
MIRT2296322	hsa-miR-4656	CLIP-seq
MIRT2296323	hsa-miR-4675	CLIP-seq
MIRT1235206	hsa-miR-4724-3p	CLIP-seq
MIRT2069245	hsa-miR-4728-5p	CLIP-seq
MIRT2296324	hsa-miR-4736	CLIP-seq
MIRT2296325	hsa-miR-4741	CLIP-seq
MIRT2296326	hsa-miR-646	CLIP-seq
MIRT2296327	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	20307683
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18593906
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16713569, 25416956, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0006468	Process	Protein phosphorylation	IDA	18593906
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20307683
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0016236	Process	Macroautophagy	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18675992
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IMP	20307683
GO:0050821	Process	Protein stabilization	ISS
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 300295
• HGNC: 8987
• e!Ensembl: ENSG00000102096

Protein

• UniProt ID: Q9P1W9
• Protein name: Serine/threonine-protein kinase pim-2 (EC 2.7.11.1) (Pim-2h)
• Protein function: Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulatio
• PDB: 2IWI, 4X7Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	32 → 286	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in hematopoietic tissues, in leukemic and lymphoma cell lines, testis, small intestine, colon and colorectal adenocarcinoma cells. Weakly expressed in normal liver, but highly expressed in hepatocellular carcinoma tiss
• Sequence:

  MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
  KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
  PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
  IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
  DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
  GPAPLAWSLLP

• Sequence length: 311

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	17943165		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23752607		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	19458359		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	19458359		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	20215640		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23752607		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	23752607		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26064888	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28944837		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21937691		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	16932341		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23813671		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27397540, 29570932, 29985480, 31409638, 31511646		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25854938	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32641749	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19821157, 32641749, 35802648	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29541172		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23752607		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	23752607		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	28729093		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16932341, 30525315		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18031952		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34718239	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26078709		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26078709, 28306719	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	21937691		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31358902		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36109523	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	23813671		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29781812		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	20145274		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	29541172		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	19821157		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	26643319		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24505470	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	35130915	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20215640, 25071334, 28944837		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23752607, 31671637	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19458359, 23752607	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	19458359		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20215640, 23752607, 24975213, 26500282, 26764044, 28914261, 31186757		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18675992, 19821157, 30593845		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	32641749	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	33675743	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16143398		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18675992, 20215640		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23752607, 31671637	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	21937691	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	21937691		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27397540, 29570932, 29985480, 31409638, 31511646		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31358902		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29541172		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15715935, 16015593, 20145274, 29124675		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30340823		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17943165, 22506047, 24142698, 26500282, 29541172, 30802730, 31186757, 31501481		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	31409638		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	21937691, 22955922		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	21937691		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12200383, 26500282, 27564460, 35108359	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21475253, 23818547, 26500282, 27564460, 28008178, 29327347		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	31186757		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18675992, 27448973, 28938604, 29928488, 30340823, 31358902, 31511646		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36907773	Associate	★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	Pubtator	15308563	Stimulate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30658101		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15715935, 16015593, 20145274, 23813671, 29124675		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16015593		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24767770, 33932111	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26064888		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30340823		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29879757	Associate	★☆☆☆☆ Found in Text Mining only