PIK3CG (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma)

Gene

• Entrez ID: 5294
• Gene name: Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
• Gene symbol: PIK3CG
• Synonyms (NCBI Gene): IMD97, PI3CG, PI3K, PI3Kgamma, PIK3, p110gamma, p120-PI3K
• Chromosome: 7
• Chromosome location: 7q22.3
• Summary: Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta)

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006815	hsa-miR-29b-3p	Microarray, qRT-PCR, Western blot	22297492
MIRT006831	hsa-miR-126-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22900072
MIRT019349	hsa-miR-148b-3p	Microarray	17612493
MIRT029342	hsa-miR-26b-5p	Microarray	19088304
MIRT006831	hsa-miR-126-3p	Microarray, qRT-PCR, Western blot, SILAC (Stable Isotope Labeling of Amino acids in Culture)	23142521
MIRT437359	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR	24086481
MIRT437359	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR	24086481
MIRT438408	hsa-miR-10a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24522205
MIRT438408	hsa-miR-10a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24522205
MIRT438277	hsa-miR-7-5p	Luciferase reporter assay, Western blot	24603851
MIRT438408	hsa-miR-10a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24522205
MIRT438408	hsa-miR-10a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24522205
MIRT438277	hsa-miR-7-5p	Luciferase reporter assay, Western blot	24603851
MIRT516718	hsa-miR-8485	HITS-CLIP	21572407
MIRT516717	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT516716	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT516715	hsa-miR-603	HITS-CLIP	21572407
MIRT516714	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT542013	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT516713	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT516707	hsa-miR-3941	HITS-CLIP	21572407
MIRT516706	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT516705	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT516704	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT693454	hsa-miR-548a-3p	HITS-CLIP	23313552
MIRT693453	hsa-miR-548ar-3p	HITS-CLIP	23313552
MIRT693452	hsa-miR-548az-3p	HITS-CLIP	23313552
MIRT693451	hsa-miR-548e-3p	HITS-CLIP	23313552
MIRT693450	hsa-miR-548f-3p	HITS-CLIP	23313552
MIRT693449	hsa-miR-5582-3p	HITS-CLIP	23313552
MIRT693448	hsa-miR-548g-3p	HITS-CLIP	23313552
MIRT516718	hsa-miR-8485	HITS-CLIP	23313552
MIRT516714	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT542013	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT693447	hsa-miR-3163	HITS-CLIP	23313552
MIRT542012	hsa-miR-410-3p	HITS-CLIP	23313552
MIRT516713	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT693446	hsa-miR-511-3p	HITS-CLIP	23313552
MIRT516712	hsa-miR-4679	HITS-CLIP	23313552
MIRT516711	hsa-miR-3689a-5p	HITS-CLIP	23313552
MIRT516710	hsa-miR-3689b-5p	HITS-CLIP	23313552
MIRT516709	hsa-miR-3689e	HITS-CLIP	23313552
MIRT516708	hsa-miR-3689f	HITS-CLIP	23313552
MIRT516705	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT516704	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT516718	hsa-miR-8485	PAR-CLIP	21572407
MIRT516717	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT516716	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT516715	hsa-miR-603	PAR-CLIP	21572407
MIRT516714	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT542013	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT542012	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT516713	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT516707	hsa-miR-3941	PAR-CLIP	21572407
MIRT516706	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT516705	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT516704	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT516718	hsa-miR-8485	PAR-CLIP	23446348
MIRT516717	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT516716	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT516715	hsa-miR-603	PAR-CLIP	23446348
MIRT516714	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT516713	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT516712	hsa-miR-4679	PAR-CLIP	23446348
MIRT516711	hsa-miR-3689a-5p	PAR-CLIP	23446348
MIRT516710	hsa-miR-3689b-5p	PAR-CLIP	23446348
MIRT516709	hsa-miR-3689e	PAR-CLIP	23446348
MIRT516708	hsa-miR-3689f	PAR-CLIP	23446348
MIRT516707	hsa-miR-3941	PAR-CLIP	23446348
MIRT516706	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT516705	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT516704	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT439973	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT439973	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT006831	hsa-miR-126-3p	Luciferase reporter assay	27729613
MIRT006831	hsa-miR-126-3p	qRT-PCR, Western blot	26659078
MIRT516718	hsa-miR-8485	HITS-CLIP	21572407
MIRT516717	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT516716	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT516715	hsa-miR-603	HITS-CLIP	21572407
MIRT516714	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT542013	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT516713	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT516707	hsa-miR-3941	HITS-CLIP	21572407
MIRT516706	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT516705	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT516704	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT693454	hsa-miR-548a-3p	HITS-CLIP	23313552
MIRT693453	hsa-miR-548ar-3p	HITS-CLIP	23313552
MIRT693452	hsa-miR-548az-3p	HITS-CLIP	23313552
MIRT693451	hsa-miR-548e-3p	HITS-CLIP	23313552
MIRT693450	hsa-miR-548f-3p	HITS-CLIP	23313552
MIRT693449	hsa-miR-5582-3p	HITS-CLIP	23313552
MIRT693448	hsa-miR-548g-3p	HITS-CLIP	23313552
MIRT516718	hsa-miR-8485	HITS-CLIP	23313552
MIRT516714	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT542013	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT693447	hsa-miR-3163	HITS-CLIP	23313552
MIRT542012	hsa-miR-410-3p	HITS-CLIP	23313552
MIRT516713	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT693446	hsa-miR-511-3p	HITS-CLIP	23313552
MIRT516712	hsa-miR-4679	HITS-CLIP	23313552
MIRT516711	hsa-miR-3689a-5p	HITS-CLIP	23313552
MIRT516710	hsa-miR-3689b-5p	HITS-CLIP	23313552
MIRT516709	hsa-miR-3689e	HITS-CLIP	23313552
MIRT516708	hsa-miR-3689f	HITS-CLIP	23313552
MIRT516705	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT516704	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT516718	hsa-miR-8485	PAR-CLIP	21572407
MIRT516717	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT516716	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT516715	hsa-miR-603	PAR-CLIP	21572407
MIRT516714	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT542013	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT542012	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT516713	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT516707	hsa-miR-3941	PAR-CLIP	21572407
MIRT516706	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT516705	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT516704	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT516718	hsa-miR-8485	PAR-CLIP	23446348
MIRT516717	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT516716	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT516715	hsa-miR-603	PAR-CLIP	23446348
MIRT516714	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT516713	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT516712	hsa-miR-4679	PAR-CLIP	23446348
MIRT516711	hsa-miR-3689a-5p	PAR-CLIP	23446348
MIRT516710	hsa-miR-3689b-5p	PAR-CLIP	23446348
MIRT516709	hsa-miR-3689e	PAR-CLIP	23446348
MIRT516708	hsa-miR-3689f	PAR-CLIP	23446348
MIRT516707	hsa-miR-3941	PAR-CLIP	23446348
MIRT516706	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT516705	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT516704	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1234187	hsa-miR-1276	CLIP-seq
MIRT1234188	hsa-miR-1976	CLIP-seq
MIRT1234189	hsa-miR-24	CLIP-seq
MIRT1234190	hsa-miR-3199	CLIP-seq
MIRT1234191	hsa-miR-3653	CLIP-seq
MIRT1234192	hsa-miR-3658	CLIP-seq
MIRT1234193	hsa-miR-378g	CLIP-seq
MIRT1234194	hsa-miR-4269	CLIP-seq
MIRT1234195	hsa-miR-4437	CLIP-seq
MIRT1234196	hsa-miR-4438	CLIP-seq
MIRT1234197	hsa-miR-4496	CLIP-seq
MIRT1234198	hsa-miR-4514	CLIP-seq
MIRT1234199	hsa-miR-4674	CLIP-seq
MIRT1234200	hsa-miR-4692	CLIP-seq
MIRT1234201	hsa-miR-4722-3p	CLIP-seq
MIRT1234202	hsa-miR-4742-5p	CLIP-seq
MIRT1234203	hsa-miR-4778-3p	CLIP-seq
MIRT1234204	hsa-miR-5095	CLIP-seq
MIRT1234205	hsa-miR-619	CLIP-seq
MIRT1234206	hsa-miR-885-5p	CLIP-seq
MIRT2068989	hsa-miR-1200	CLIP-seq
MIRT2068990	hsa-miR-1289	CLIP-seq
MIRT2068991	hsa-miR-1343	CLIP-seq
MIRT2068992	hsa-miR-1911	CLIP-seq
MIRT1234188	hsa-miR-1976	CLIP-seq
MIRT1234189	hsa-miR-24	CLIP-seq
MIRT2068993	hsa-miR-3198	CLIP-seq
MIRT1234190	hsa-miR-3199	CLIP-seq
MIRT1234193	hsa-miR-378g	CLIP-seq
MIRT1234194	hsa-miR-4269	CLIP-seq
MIRT2068994	hsa-miR-4294	CLIP-seq
MIRT2068995	hsa-miR-4309	CLIP-seq
MIRT2068996	hsa-miR-4324	CLIP-seq
MIRT1234195	hsa-miR-4437	CLIP-seq
MIRT1234196	hsa-miR-4438	CLIP-seq
MIRT1234198	hsa-miR-4514	CLIP-seq
MIRT2068997	hsa-miR-4534	CLIP-seq
MIRT1234199	hsa-miR-4674	CLIP-seq
MIRT1234200	hsa-miR-4692	CLIP-seq
MIRT1234201	hsa-miR-4722-3p	CLIP-seq
MIRT1234202	hsa-miR-4742-5p	CLIP-seq
MIRT1234204	hsa-miR-5095	CLIP-seq
MIRT2068998	hsa-miR-544b	CLIP-seq
MIRT2068989	hsa-miR-1200	CLIP-seq
MIRT2068992	hsa-miR-1911	CLIP-seq
MIRT1234188	hsa-miR-1976	CLIP-seq
MIRT1234189	hsa-miR-24	CLIP-seq
MIRT2296006	hsa-miR-2467-3p	CLIP-seq
MIRT2296007	hsa-miR-3125	CLIP-seq
MIRT2296008	hsa-miR-3692	CLIP-seq
MIRT1234193	hsa-miR-378g	CLIP-seq
MIRT2296009	hsa-miR-3916	CLIP-seq
MIRT2296010	hsa-miR-3925-3p	CLIP-seq
MIRT1234194	hsa-miR-4269	CLIP-seq
MIRT2296011	hsa-miR-4308	CLIP-seq
MIRT2068996	hsa-miR-4324	CLIP-seq
MIRT1234195	hsa-miR-4437	CLIP-seq
MIRT1234196	hsa-miR-4438	CLIP-seq
MIRT1234198	hsa-miR-4514	CLIP-seq
MIRT2296012	hsa-miR-4530	CLIP-seq
MIRT1234199	hsa-miR-4674	CLIP-seq
MIRT2296013	hsa-miR-4685-5p	CLIP-seq
MIRT1234200	hsa-miR-4692	CLIP-seq
MIRT1234201	hsa-miR-4722-3p	CLIP-seq
MIRT1234202	hsa-miR-4742-5p	CLIP-seq
MIRT1234203	hsa-miR-4778-3p	CLIP-seq
MIRT1234204	hsa-miR-5095	CLIP-seq
MIRT2296014	hsa-miR-515-5p	CLIP-seq
MIRT2068998	hsa-miR-544b	CLIP-seq
MIRT1234205	hsa-miR-619	CLIP-seq
MIRT2296015	hsa-miR-766	CLIP-seq
MIRT2296016	hsa-miR-922	CLIP-seq
MIRT2068989	hsa-miR-1200	CLIP-seq
MIRT2068992	hsa-miR-1911	CLIP-seq
MIRT1234188	hsa-miR-1976	CLIP-seq
MIRT1234194	hsa-miR-4269	CLIP-seq
MIRT2068996	hsa-miR-4324	CLIP-seq
MIRT1234198	hsa-miR-4514	CLIP-seq
MIRT1234200	hsa-miR-4692	CLIP-seq
MIRT1234201	hsa-miR-4722-3p	CLIP-seq
MIRT1234202	hsa-miR-4742-5p	CLIP-seq
MIRT2068998	hsa-miR-544b	CLIP-seq
MIRT2593958	hsa-miR-500a	CLIP-seq
MIRT2593959	hsa-miR-539	CLIP-seq
MIRT2593960	hsa-miR-548aa	CLIP-seq
MIRT2593961	hsa-miR-548ac	CLIP-seq
MIRT2593962	hsa-miR-548d-3p	CLIP-seq
MIRT2593963	hsa-miR-548z	CLIP-seq
MIRT2593959	hsa-miR-539	CLIP-seq
MIRT2593960	hsa-miR-548aa	CLIP-seq
MIRT2593961	hsa-miR-548ac	CLIP-seq
MIRT2593962	hsa-miR-548d-3p	CLIP-seq
MIRT2593963	hsa-miR-548z	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001819	Process	Positive regulation of cytokine production	TAS	19075988
GO:0002250	Process	Adaptive immune response	TAS	17290298
GO:0002376	Process	Immune system process	IEA
GO:0002407	Process	Dendritic cell chemotaxis	TAS	18278175
GO:0002675	Process	Positive regulation of acute inflammatory response	IEA
GO:0002679	Process	Respiratory burst involved in defense response	TAS	19075988
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IMP	18558630
GO:0004672	Function	Protein kinase activity	TAS	19376709
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	12507995, 21393242, 23824069, 25556234, 32814053, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12507995
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005942	Component	Phosphatidylinositol 3-kinase complex	IEA
GO:0005943	Component	Phosphatidylinositol 3-kinase complex, class IA	EXP	10358071
GO:0005943	Component	Phosphatidylinositol 3-kinase complex, class IA	IBA
GO:0005944	Component	Phosphatidylinositol 3-kinase complex, class IB	IBA
GO:0005944	Component	Phosphatidylinositol 3-kinase complex, class IB	IDA	12507995
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	17290298
GO:0006955	Process	Immune response	NAS	31480354
GO:0007186	Process	G protein-coupled receptor signaling pathway	EXP	10358071
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	12507995
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	7624799
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	18558630
GO:0010818	Process	T cell chemotaxis	TAS	18278175
GO:0010897	Process	Negative regulation of triglyceride catabolic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	12507995
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016303	Function	1-phosphatidylinositol-3-kinase activity	IBA
GO:0016303	Function	1-phosphatidylinositol-3-kinase activity	IDA	11277933, 16123124
GO:0016303	Function	1-phosphatidylinositol-3-kinase activity	IEA
GO:0016303	Function	1-phosphatidylinositol-3-kinase activity	TAS	7624799, 17290298
GO:0016477	Process	Cell migration	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0030593	Process	Neutrophil chemotaxis	TAS	17290298
GO:0032252	Process	Secretory granule localization	IEA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	TAS	18278175
GO:0035005	Function	1-phosphatidylinositol-4-phosphate 3-kinase activity	IBA
GO:0035005	Function	1-phosphatidylinositol-4-phosphate 3-kinase activity	IDA	16123124
GO:0035005	Function	1-phosphatidylinositol-4-phosphate 3-kinase activity	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IMP	18558630
GO:0035747	Process	Natural killer cell chemotaxis	TAS	18278175
GO:0036092	Process	Phosphatidylinositol-3-phosphate biosynthetic process	IBA
GO:0042098	Process	T cell proliferation	TAS	19075988
GO:0042110	Process	T cell activation	TAS	17290298
GO:0042802	Function	Identical protein binding	IPI	20562859, 23824069
GO:0043303	Process	Mast cell degranulation	TAS	17290298
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	12507995
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	12507995
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	18558630, 21840392
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	TAS	17290298
GO:0045087	Process	Innate immune response	TAS	17290298
GO:0045765	Process	Regulation of angiogenesis	IMP	21840392
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IDA	12502714
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	11416136
GO:0046934	Function	1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity	IBA
GO:0046934	Function	1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity	IDA	12502714, 15135396, 16123124
GO:0046934	Function	1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity	IEA
GO:0048015	Process	Phosphatidylinositol-mediated signaling	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	12507995
GO:0055118	Process	Negative regulation of cardiac muscle contraction	TAS	19147653
GO:0070527	Process	Platelet aggregation	TAS	21035500
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0072672	Process	Neutrophil extravasation	TAS	18278175
GO:0097284	Process	Hepatocyte apoptotic process	IEA
GO:0106310	Function	Protein serine kinase activity	IDA	12502714
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1903169	Process	Regulation of calcium ion transmembrane transport	IEA
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IEA

Other IDs

• MIM: 601232
• HGNC: 8978
• e!Ensembl: ENSG00000105851

Protein

• UniProt ID: P48736
• Protein name: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform (PI3-kinase subunit gamma) (PI3K-gamma) (PI3Kgamma) (PtdIns-3-kinase subunit gamma) (EC 2.7.1.137) (EC 2.7.1.153) (EC 2.7.1.154) (Phosphatidylinositol 4,5-bisphosphate 3-kinase
• Protein function: Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the memb
• PDB: 1E8Y, 1E8Z, 1HE8, 2A4Z, 2A5U, 2CHW, 2CHX, 2CHZ, 2V4L, 3APC, 3APD, 3APF, 3CSF, 3CST, 3DBS, 3DPD, 3ENE, 3IBE, 3L08, 3L13, 3L16, 3L17, 3L54, 3LJ3, 3MJW, 3ML8, 3ML9, 3NZS, 3NZU, 3OAW, 3P2B, 3PRE, 3PRZ, 3PS6, 3QAQ, 3QAR, 3QJZ, 3QK0, 3R7Q, 3R7R, 3S2A, 3SD5, 3T8M, 3TJP, 3TL5, 3ZVV, 3ZW3, 4ANU, 4ANV, 4ANW, 4ANX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00794	PI3K_rbd	203 → 312	PI3-kinase family, ras-binding domain	Domain
  PF00792	PI3K_C2	377 → 519	Phosphoinositide 3-kinase C2	Domain
  PF00613	PI3Ka	543 → 733	Phosphoinositide 3-kinase family, accessory domain (PIK domain)	Family
  PF00454	PI3_PI4_kinase	827 → 1044	Phosphatidylinositol 3- and 4-kinase	Family

• Tissue specificity: TISSUE SPECIFICITY: Pancreas, skeletal muscle, liver and heart. {ECO:0000269|PubMed:7624799}.
• Sequence:

  MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
  VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLD
  CLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
  VTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
  PGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
  EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
  FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
  KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
  VLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
  DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
  QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
  LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
  LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
  ESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
  DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
  AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
  FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
  RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
  TVQFNWFLHLVLGIKQGEKHSA

• Sequence length: 1102

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Immunodeficiency 97 with autoinflammation	Pathogenic	rs376453517, rs2116619574, rs774060880	RCV002210952 RCV002210953 RCV002204560	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic fibrosis	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT syndrome	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PIK3CG-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ACTIVATED PI3K-DELTA SYNDROME	ACTIVATED PI3K-DELTA SYNDROME	BEFREE	27116393, 27616589, 28167755, 28842185, 29556229, 30116245, 31031754		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	20445019		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	12556562, 16115127, 23705826, 24966925, 30639430, 31412710		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18483299, 18665177, 22685175, 23958920, 24244612, 26080839, 27018341, 28125433, 28159681, 28295182, 29179029, 29574283, 30669372, 30795552, 31705930		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	26999641, 29143813, 29276026, 29559471, 31217869		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29457828, 29620213, 30694771, 31414732, 31531867		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	18491231, 24676995, 27840989, 30316766, 31032633		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10972292, 12097266, 14695323, 16772787, 24037752, 24500884, 25019985, 27334835, 27845189, 30429033, 30542835		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	21943101, 25012123		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	25435423, 28867195		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	27176231, 30321514		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22684718, 23629727, 23976985, 24117074, 24469055, 24482365, 24762440, 25596284, 26023239, 26098749, 27822469, 27846317, 28009353, 28049093, 28223119, 28351312, 28503373, 29156674, 29384143, 29483824, 29516506, 29558998, 30021836, 30541897, 30590030, 30791942, 30815935, 30830869, 30849291, 31264215, 31436252, 31599423, 31646571		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	17671718, 21678117, 23950591, 27179037		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	BEFREE	27259009		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	26045339		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	30269363		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	27941887, 29339153		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	23708654, 25571954, 28184015, 31024258, 31414579		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	22692904, 23889685, 27811202, 29075302, 30217997		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30457983		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18483299, 22685175, 23958920, 26080839, 28125433, 28159681, 29179029, 29574283, 30669372, 30795552		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	20443680, 22609116, 24418330, 24938766, 25215588, 25909227, 26460954, 27348272, 28756223, 30820547		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15289331, 17375124, 30352904		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	16398471, 16707597, 18281460, 21652733, 24584142, 25601471, 25915540, 28159923, 29377550, 29682173, 29805559, 30050750		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	21652733		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	30975663		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	24569712, 26269411, 29077243, 31744878		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21964287, 23441106		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	17669465, 28230926		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21625490, 29885866		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22982105	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	15192701		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28844000, 28971495, 30345917, 31237881		★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	30530704, 30582752, 30888976		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	17235514		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	17317825, 18492751, 20578891, 22190384, 23386415, 25016932, 25347569, 26477313, 27618325, 27797976, 28600475, 29301825, 29487290, 30243708, 30699064		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	27369867		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28696014		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	39245801	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17483325, 20876794, 21829709, 21984975, 23453624, 24895459, 25452273, 25673820, 26158412, 26219899, 26715645, 27179037, 27339327, 27705906, 28176634, 28423617, 28544376, 28574828, 29040676, 29386088, 29670543, 29898401, 30065098, 30087712, 30243721, 30261145, 30396902, 30896829, 31088502, 31153980, 31452773		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	38175709	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29123158, 30905780, 31170866		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	30037818, 30635471, 31636720		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29137319		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	17669465, 28230926		★☆☆☆☆ Found in Text Mining only
Arnold-Chiari Malformation, Type I	Arnold-Chiari malformation	BEFREE	31363831		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	30872976, 31798637		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17255531, 18268153, 20056919, 24951662, 25849952, 26658747, 27919735, 28461772, 29177114, 29203244, 29668625, 30241919, 30887395, 30891776, 31035012, 31159424, 31187710, 31214032, 31237148, 31306371, 31609302		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19734303, 24385683, 28733141, 29328461, 30954464, 31392775		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	26748475		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22015454, 22981793, 23428345, 24583134, 27556731, 28293189, 28746467, 29504610, 29554934, 30146725, 30149919, 30334401, 30406061, 30478434, 30542075, 31323822, 31747880		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29298996	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21125662, 23370326		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	18492751, 23201008, 31189575		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17255531, 18268153, 20056919, 24951662, 25849952, 26658747, 27919735, 28461772, 29177114, 29203244, 29668625, 30887395, 30891776, 31035012, 31159424, 31187710, 31214032, 31237148, 31306371, 31609302		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24951662, 28260035, 34115567	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30664154		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	19458356		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	19458356, 29097255		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	17506723		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19545994, 23269408, 26770665, 30061744, 31007884		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	14627686		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	16675386, 26770665		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20056919, 22840496, 26324350, 26658520, 27791035, 28713374, 29109121, 29115519, 29246441, 29492193, 29847724, 29867948, 30018141, 30384445, 30429249, 30498491, 30582813, 30666254, 30799802, 30921706, 31031754, 31076529		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30018141	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	28434922		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	28115173		★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	31534468		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	18704194		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17375124		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23300274, 23403624, 24920406, 25124606, 25862915, 26549638, 28147336, 28693262, 29042957, 29201192, 29328385, 29414639, 29423015, 29518396, 29774105, 29781323, 29916537, 30061946, 30127928, 30178865, 30278824, 30472432, 30549430, 30609049, 30679990, 30783438, 31111379, 31115571, 31239698, 31389591, 31547366, 31552178, 31583927, 31601188, 31618892		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	20534739, 29709906		★☆☆☆☆ Found in Text Mining only
Bannayan-Riley-Ruvalcaba Syndrome	Bannayan-Riley-Ruvalcaba Syndrome	BEFREE	17405772		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29456672, 30295140, 30900311		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	27020207		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	25742482, 29024814, 29416916, 29474549, 30370571		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19789314, 19875696, 20354165, 22285928, 22906492, 23224295, 23300058, 24347284, 24442130, 24952510, 25349966, 25812440, 26312564, 26597249, 27726892, 27823983, 28647190, 28808038, 28889395, 29070760, 29190973, 29357370, 29383014, 29454321, 29670371, 29725263, 29749527, 30845932, 30941989, 31298367, 31527329, 31605287, 31692549, 31696468		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	20526338	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30471112		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31173224		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	16288007, 20473884, 21861842, 24162827, 27553832, 27926496, 27935819, 28292440, 28556811, 29326882, 29718345, 30018387		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11507039, 11597319, 11706404, 12670921, 12866037, 12970748, 15001399, 15367412, 15472226, 15580312, 15837735, 16168140, 16424042, 16582596, 16755107, 16951146, 17314276, 17452630, 17936563, 18498248, 18518979, 18652687, 18676830, 18725974, 19148520, 19366795, 19395875, 19567590, 19609946, 19661335, 19685490, 19751211, 19881546, 19882362, 19946332, 20112503, 20372866, 20424113, 20453058, 20471474, 20479250, 20480226, 20530877, 20538763, 20569503, 20664923, 20803067, 20940279, 21076301, 21172654, 21209903, 21216892, 21278436, 21362200, 21406469, 21420991, 21676217, 21904903, 21932171, 21946274, 22060274, 22094188, 22114931, 22262199, 22266096, 22329846, 22414288, 22454081, 22488590, 22534171, 22710837, 22841774, 22915751, 22922893, 22952425, 22960556, 23085752, 23089982, 23092874, 23184205, 23222510, 23248119, 23301057, 23314198, 23319441, 23343422, 23389849, 23448424, 23500535, 23612454, 23635776, 23643661, 23663564, 23814023, 23903756, 23982433, 24001613, 24011769, 24121471, 24229379, 24269953, 24277465, 24356815, 24403602, 24470511, 24493024, 24601221, 24706460, 24756995, 24782652, 24836190, 24879796, 24981670, 24991009, 25002028, 25036402, 25056500, 25071141, 25127034, 25155268, 25199759, 25201346, 25327287, 25355053, 25379017, 25401474, 25422220, 25458846, 25491778, 25542038, 25542856, 25559818, 25566992, 25586125, 25702787, 25760096, 25801958, 25808869, 25816324, 25877889, 25961924, 25979232, 26095475, 26116361, 26134759, 26191181, 26194618, 26208487, 26215189, 26239613, 26260992, 26267533, 26289070, 26316702, 26452060, 26515594, 26540293, 26595803, 26643256, 26676464, 26681740, 26733612, 26758558, 26839307, 26840401, 26895380, 26921096, 26939876, 26945854, 26995633, 27004402, 27059323, 27088857, 27171498, 27211281, 27221510, 27282497, 27374081, 27426307, 27553366, 27563827, 27600857, 27604488, 27626181, 27639383, 27771839, 27803006, 27848885, 27864123, 27940576, 28060760, 28123607, 28160548, 28165066, 28176176, 28196852, 28228253, 28231748, 28276317, 28296140, 28296189, 28336670, 28381172, 28382169, 28383549, 28396358, 28407679, 28418910, 28423632, 28446508, 28454214, 28459209, 28495456, 28498520, 28513879, 28518139, 28533273, 28539475, 28576675, 28599470, 28600142, 28756150, 28779263, 28791358, 28791363, 28810530, 28854595, 28856747, 28861172, 28881779, 28902361, 28910567, 28915591, 28923573, 28929029, 28969041, 28991258, 29086897, 29103666, 29107429, 29127189, 29128895, 29130495, 29169282, 29252036, 29259101, 29262587, 29310608, 29316252, 29345357, 29355544, 29399197, 29430197, 29482551, 29504069, 29524295, 29545474, 29550144, 29550515, 29568883, 29574068, 29599830, 29636477, 29689598, 29700210, 29715106, 29721370, 29725474, 29736694, 29737572, 29774109, 29791862, 29792310, 29808803, 29851245, 29863252, 29906308, 29925528, 29928143, 29942081, 29942710, 29951132, 30038508, 30038517, 30038706, 30076411, 30078647, 30103105, 30126855, 30148117, 30207362, 30212931, 30220978, 30266800, 30272349, 30287915, 30315845, 30318472, 30357946, 30368861, 30426328, 30454896, 30483746, 30515357, 30515835, 30518672, 30540926, 30542378, 30578411, 30628639, 30652303, 30662797, 30671946, 30678711, 30737233, 30767161, 30796030, 30820547, 30880072, 30898150, 30903140, 30930461, 30943409, 31005809, 31006103, 31018950, 31104012, 31124219, 31142739, 31159599, 31173106, 31195751, 31235687, 31256368, 31257479, 31277699, 31313132, 31317673, 31320990, 31322299, 31359335, 31391067, 31408722, 31417306, 31417861, 31448883, 31464004, 31539632, 31552922, 31636652, 31660072, 31660083, 31683659, 31688991, 31696760, 31710162, 31751581, 31761784, 31781306, 31786856, 31787861, 31798622, 31822498, 31824171, 31828441		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16582596, 20551053, 21172654, 30050147, 35383130, 36892268, 40650045	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23500535	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	14734735, 22897848, 23603894, 24577510, 28619753, 29463831, 29774105, 30333121, 30617194, 30881494, 31719683		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	29326158		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	24725463	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	18789327, 24041865		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26743283, 32366932, 38287309	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11959846, 15548710, 18181165, 18604870, 19055754, 20103642, 21317880, 21423156, 22969158, 23056620, 23172887, 23588386, 27465249, 27738081, 27873319, 29035827, 29156516, 30105951, 30206202, 30289966, 31752936		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	23500535	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	27611608, 29807574		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19789314, 19875696, 20354165, 22285928, 22906492, 23224295, 23300058, 24347284, 24442130, 24952510, 25349966, 25812440, 26312564, 26597249, 27726892, 27823983, 28042869, 28647190, 28808038, 28889395, 29070760, 29190973, 29357370, 29383014, 29670371, 29725263, 29749527, 30845932, 30941989, 31298367, 31527329, 31605287, 31692549, 31696468		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26238658, 26600164, 27373675, 29085504, 29299828, 29312563, 30464533		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12714585, 19337377, 20375364, 20596634, 20811722, 20818420, 20959404, 21220474, 21688263, 21861134, 21996732, 22363436, 22941571, 23045273, 23111416, 23172887, 23454899, 23728071, 23955080, 24085243, 24469108, 24472538, 24533074, 24788552, 24972969, 25266803, 25524703, 25573345, 25673697, 25738369, 25861627, 26013318, 26517240, 26645682, 27041574, 27121230, 27177359, 27221310, 27881463, 27930981, 28108151, 28125432, 28173828, 28259980, 28336809, 28356026, 28662101, 28748356, 28782471, 28847905, 28901268, 29115573, 29132432, 29171984, 29269744, 29328421, 29504919, 29508110, 29516506, 29616103, 29620222, 29669316, 29864375, 29961813, 30058690, 30190703, 30344755, 30365050, 30431081, 30481052, 30590030, 30779080, 30787353, 30806240, 30825612, 30896825, 31115514, 31128006, 31262325, 31337981, 31452780, 31748336		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	27986751		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29635281, 31259714, 40419510	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	20557351, 22082146, 27982029, 30675221		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	23765252		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	25441311, 26087898, 29545879		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11531284, 11706404, 16452192, 16545436, 17178867, 17875760, 18270270, 19029838, 19151754, 20661217, 21372221, 22340595, 22585163, 23371322, 23408974, 23591839, 23652833, 23680521, 23708104, 23970345, 24011934, 24022196, 24115647, 24237932, 24247248, 24718516, 25216292, 25405658, 25677064, 25776272, 25852062, 26159849, 26657155, 26909613, 26983899, 27082164, 27840916, 28002999, 28350104, 28574782, 28770968, 29113199, 29286125, 29371953, 29401696, 29743815, 29909423, 29930760, 29996940, 30129654, 30237504, 30245957, 30697076, 30755818, 30880072, 30909184, 30925458, 30941821, 30972187, 31128298, 31173282, 31234823, 31284467, 31371979, 31638241		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17404510, 29156374, 30567315, 31806860		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	17202264, 30776465		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	17202264, 30070262, 30216493, 30776465, 31572181		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	30941910		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	35205232	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16543958, 26658520, 28729453, 29376419, 29502072, 30066927, 30651001, 31016532, 31187710, 31360208		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28260035	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31178586, 31685084		★☆☆☆☆ Found in Text Mining only
CATARACT, COPPOCK-LIKE	Cataract	BEFREE	27581127		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28434922		★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	29486290, 30677238		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	27926496		★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	30057669		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	22119079, 28395173, 28402976, 28478514, 29272009, 29917203, 29981053, 30015915, 30073508, 30156477, 30245466, 30662601, 31265179, 31298389, 31389591, 31836786		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36691064	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29102966		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15573409, 24797366, 28785051, 31143233, 31595881		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	20657188, 22229477, 22235101, 23899375, 25135429, 25310288, 25738254, 25962638, 26183061, 26802646, 27388585, 28036259, 28475243, 29175387, 29236322, 29312623, 29316891, 29328485, 29423104, 29777148, 29898430, 30006571, 30127216, 30272334, 30459531, 30480801, 30547809, 30552693, 30619121, 30641218, 31056260, 31210294, 31295843, 31545455		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	20657188, 22229477, 22235101, 23899375, 25135429, 25310288, 25738254, 25962638, 26183061, 26802646, 27388585, 28036259, 28386355, 28475243, 29175387, 29236322, 29312623, 29316891, 29328485, 29423104, 29777148, 29898430, 30006571, 30127216, 30272334, 30459531, 30480801, 30552693, 30619121, 30641218, 31056260, 31210294, 31295843, 31545455		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18483299, 22685175, 23958920, 26080839, 28125433, 28159681, 29179029, 29574283, 30669372, 30795552		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	16398471, 16707597, 18281460, 21652733, 24584142, 25601471, 25915540, 28159923, 29377550, 29682173, 29805559, 30050750		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	21652733		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	30975663		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	17461449, 25826091, 28670110, 30008846, 30514341		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	23152722, 28500348, 29191461		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	31663994		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	18720410		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	21344378, 23714727, 23922104, 25301739		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	19401700, 23533570, 28753115		★☆☆☆☆ Found in Text Mining only
Chorea Acanthocytosis Syndrome	Chorea	BEFREE	29253590		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	19549922, 26093985, 27714811		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28421341, 29049990, 30215298, 31189876		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18665177, 18784741, 20534739, 20660292, 20861921, 22623730, 23482887, 24229693, 24825182, 25258342, 25430416, 25917267, 26350103, 26889681, 27040704, 28017967, 28061982, 28112970, 28192408, 28257435, 28388280, 28489572, 28835371, 28942659, 28945111, 29122897, 29179250, 29246942, 29479062, 29480432, 29855199, 30134797, 30182737, 30457982, 30558987, 30967392, 31203516, 31216925, 31462739, 31519585, 31710039, 31831562		★☆☆☆☆ Found in Text Mining only
Chronic mountain sickness	Mountain sickness	BEFREE	29176544		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	22227528, 22806893, 24237791, 24251790, 24290217, 26062813, 26275051, 30730307		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22015454, 23029326, 28522564, 29557740, 30066869, 30115538, 30741829, 30827233, 30860857		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	31351582		★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	30057669		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	27056978		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	12963636		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	23894275, 24425104		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28342896, 28599877, 29290948, 29516284, 29723552, 30175975, 31004737, 31281447		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20347874, 20580720, 23867870, 28587873, 30385297, 30920609		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10625637, 10972292, 11756194, 12473596, 16153452, 16772787, 17575153, 18064605, 18627290, 19572978, 20204404, 21713600, 22543857, 23251002, 23593290, 23708654, 24398569, 24756222, 24930890, 25199763, 25314071, 25554016, 25732087, 26225471, 26615871, 27671687, 28259918, 28432271, 28782499, 28811711, 28881576, 28979133, 29130099, 29305742, 29523145, 29560517, 30023564, 30195873, 30257389, 30396937, 30551398, 30941956, 31500630, 31510692, 31596728		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17148604, 21966435, 31830892		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18245521, 18451140		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10972292, 12473596, 15183529, 15592509, 15930273, 16094359, 16357568, 16772787, 19885597, 20130434, 21102582, 21199803, 21910030, 21966435, 21985784, 22392911, 22496919, 22553375, 22696593, 22851869, 22982087, 23251002, 23354733, 23549875, 23583404, 23604118, 23725225, 23743569, 23824282, 23826249, 23930204, 23960014, 23990352, 23992303, 24231454, 24317328, 24393708, 24398569, 24581231, 24666267, 25023051, 25100204, 25356626, 25365190, 25374184, 25389372, 25450577, 25571954, 25591826, 25714871, 25749388, 25920435, 26045788, 26224641, 26224873, 26238857, 26272063, 26358176, 26404261, 26510091, 26647806, 26718987, 26719016, 26722535, 26741506, 26787540, 26847718, 26955235, 27350731, 27469030, 27573904, 27602501, 27626684, 27694004, 27889608, 27913571, 27941887, 28087713, 28107519, 28184015, 28230287, 28300833, 28315345, 28352192, 28418896, 28513830, 28559972, 28562687, 28584719, 28656212, 28708103, 28738539, 28771224, 28822989, 28835319, 28884839, 28939743, 29050940, 29068474, 29118671, 29222171, 29260353, 29277893, 29321086, 29339153, 29421609, 29422975, 29496520, 29496555, 29636999, 29666061, 29689497, 29845289, 29901203, 29970122, 29970892, 29978469, 30129057, 30147336, 30243491, 30410397, 30468657, 30472186, 30582752, 30623365, 30636581, 30639585, 30683840, 30691487, 30832706, 30905967, 30933440, 30985693, 31017126, 31036754, 31043791, 31060539, 31164625, 31164794, 31215384, 31298352, 31357480, 31430901, 31448575, 31501538, 31506897, 31648230, 31664539, 31704733, 31815051, 31830892		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11756194, 22675430, 27296289, 31548566, 35546360, 35785488	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12473596, 17410437		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19731079, 28087713, 30550927		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	31036380		★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	26637981, 27030595, 30855339		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	28530660, 29976569		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	25322685, 29470683		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	18181165, 21325635, 25826091, 26657242, 30008846, 30308494, 30316146, 31456644, 31638221		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	31806860		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	26720608		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	12963636		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	14597618, 17404510, 17885560, 21631421, 28624424, 28904868, 29115471, 29209026, 29574918, 30864233, 30974752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16707436, 17468516, 18587247, 22950635, 23086777, 23219378, 23416459, 23797736, 23900601, 24107265, 24448243, 24767687, 25714556, 25757764, 25925728, 26537074, 27387559, 27453294, 27844272, 27983909, 28049139, 28114284, 28350788, 29148041, 29228703, 29635281, 29667779, 29799306, 30046388, 30327302, 30349421, 30431104, 30465826, 30607788, 30655739, 30723697, 30774762, 30964104, 30968158, 31040915, 31081053, 31173226, 31259714, 31485634, 31522588, 31545453, 31743108		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19103156, 25787015, 28885323, 29658565, 29689553, 30402501, 30906453, 31082728, 31090947, 31120192, 31341503, 31377586		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19103156, 28885323, 30906453, 31090947, 31341503		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	28885323	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19103156, 28885323, 30906453, 31090947, 31341503		★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	28969385		★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	25367099		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31363831		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23962154, 31358861		★☆☆☆☆ Found in Text Mining only
CTLA4 deficiency	CTLA4 Deficiency	BEFREE	26735698		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28794469, 28883468, 29246444		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystitis	Cystitis	BEFREE	30166343		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22662110, 26718307, 26934912, 26972586, 27930985, 28320092, 28590075, 29168867, 29245931, 29323710, 29434702, 29532889, 29636866, 30160278, 30248539, 30261492, 30417459, 30451865, 30500068, 30542428, 30922122, 30938722, 31020644, 31162482, 31325727, 31460867, 31472145, 31497826, 31572500, 31652455, 31695756, 31711940, 31712854, 31777535, 31829201		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	26946964		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	22575597		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28488208, 30178865		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27483380, 30063009, 30105773, 31353678, 31491407, 31618892, 31770536		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30288224		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	16085391, 30737086		★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	21652733		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	31831213		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15127203, 21861804, 23747931, 23827786, 23880101, 24157451, 27422446, 28477532, 28584284, 28654509, 28842968, 28904022, 29526571, 29540859, 29724723, 29953446, 30210687, 30515357, 30959144, 31250153		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15127203, 21478266, 21861804, 23747931, 23827786, 23880101, 24157451, 24306208, 26648531, 27422446, 28477532, 28584284, 28654509, 28842968, 28904022, 29042442, 29486734, 29526571, 29540859, 29634420, 29724723, 29953446, 30210687, 30237226, 30515357, 30959144, 31250153, 31317389, 31336140, 31539141		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27207584, 27791035, 28081180, 28915718, 30387830, 30651870, 30973884, 31663655		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10768097, 11246893, 15127203, 15653324, 20107106, 23272147, 23551103, 26063468, 26175178, 27506476, 28045971, 28134520, 28142314, 28225806, 28477532, 28573460, 28922161, 29435181, 29552086, 29669306, 29990865, 30041644, 30050458, 30175975, 30250521, 30263000, 30421394, 30684218, 30773997, 30805369, 30824102, 31108940, 31179340, 31275108, 31275749, 31332162, 31363081, 31493479, 31609623, 31849586		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28081180		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27422446, 28487469, 31131539		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22056625, 25754093, 26849944, 27029904, 27965087, 29201232, 30128961, 30263007, 30361091, 30896854, 30899370, 31668144, 31799676		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30835506, 31593688, 31702490, 31702491, 31759996		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	18762555, 30365150, 31289610		★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	28189993, 29760046		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15331441, 18382359, 19223503, 20443680, 21173233, 22609116, 23200668, 23636313, 23764004, 24418330, 24938766, 25215588, 25909227, 26460954, 26549638, 26961147, 27348272, 27980108, 28202458, 28639315, 28750570, 28756223, 29246942, 29572378, 29617050, 30134175, 30322870, 30801854, 30820547, 30881494, 31471373, 31775867, 31831562		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	21173233		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	23319441		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	28115173		★☆☆☆☆ Found in Text Mining only
Dysembryoplastic neuroepithelial tumor	Dysembryoplastic Neuroepithelial Tumor	BEFREE	31617914		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	23157623		★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	30184529		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21478295, 23674493, 23702729, 25701704		★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	24311633		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	24793135, 25002625		★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	28410203		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11309338, 15067356, 16273242, 16322209, 16525671, 16567092, 16949921, 17427168, 17471559, 17924977, 18829572, 19234438, 19261849, 19853286, 19917135, 20062086, 20173732, 20664599, 21478295, 21687953, 21984976, 22075757, 22146979, 22301702, 22662154, 22911820, 23028188, 23235274, 23319822, 23538402, 23674493, 23702729, 24366110, 24561032, 24651628, 24995579, 25141911, 25624430, 25701704, 25862896, 26045339, 26193427, 26485755, 27259051, 27420608, 27613818, 27910071, 28002804, 28119489, 28184015, 28202507, 28860563, 28886696, 28945226, 29081412, 29182407, 29426295, 29854314, 30104481, 30319275, 30338797, 30402135, 30569174, 30574817, 30779215, 30853360, 31176047, 31233196, 31486482, 31527078, 31545414, 31588998, 31714586, 31752654		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28860563	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	16210010, 19932734, 24154570, 26899323, 28544021, 28856757, 29762822, 31144476, 31219551, 31273584, 31461309, 31637941		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	40187212	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	24077346		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26345935, 29399113, 29858824, 29901097, 30542433, 30684126, 30922159, 31563029, 31654704		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	31786159		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	27056978, 28968539, 29615724, 31625572		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17875760, 19151754, 20661217, 23680521, 23708104, 24237932, 24718516, 25405658, 28002999, 28350104, 28770968, 29286125, 29996940, 30697076, 30880072, 30909184, 30941821, 31173282, 31234823, 31371979		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	11959846, 27117832, 30670492		★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	25377560		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29174980		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17638919, 18262558, 19164214, 25435423, 25912437, 27239113, 28109079, 28384037, 28867195, 29207170, 29285246, 29456742, 29604392, 30368517, 30636576, 30942438, 31091245		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17638919, 18262558, 19164214, 25435423, 27239113, 28109079, 28384037, 28867195, 29285246, 29456742, 29604392, 30368517, 30636576, 30942438, 31091245		★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	22114931		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	11803474, 19205734, 23681745, 26336820, 26969300, 29541208, 30926641		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	31261148		★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	BEFREE	29851132		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	15192701, 18184791		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	26317790, 27471841, 28867195		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28357399, 28905319, 29724723, 30819264, 31790897		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29724723, 30248539, 31702809		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	27748285		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12169689, 31173185		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24326778, 28095306, 28104102, 28371611, 28830755, 28839277, 29098317, 29749545, 29881350, 31213776, 31378124, 31494146, 31505837, 31632567, 31835352		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	30687088		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	28457820, 30687088		★☆☆☆☆ Found in Text Mining only
FOCAL CORTICAL DYSPLASIA OF TAYLOR	Focal cortical dysplasia	BEFREE	26345935, 31337748		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	17317825, 17426084, 18055323, 18480379, 18492751, 20001715, 20578891, 22280229, 26820593, 28551845		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	20702695, 22207187, 30061744		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	29787599		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25623055, 26947513, 27317099, 28656003, 28766687, 29413947, 29416013, 29954840, 30276551, 31411121		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	29963264		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26968576, 31705880		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	27323780		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	16220453		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	28777148, 31553483		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16461335, 19860642, 21906875, 22489693, 23231951, 24706111, 25316817, 25757539, 26587973, 26796526, 28777148, 29183145, 29277888, 29545835, 29902839, 30405821, 30537795, 30551450, 30714229, 31308757, 31553483		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	32004387	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	16188233		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	21325635		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	21325635		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	29122897		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29065394, 30183321, 31680442		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10958682, 12545160, 14655756, 15605984, 16007122, 16150119, 16849522, 17050665, 17210246, 17235514, 17616812, 18215105, 18328427, 18413797, 18566746, 19076776, 19549905, 19633683, 20068170, 20392929, 20473884, 20857497, 20861085, 20888802, 21040711, 21063898, 21276823, 21538561, 21613208, 21908773, 22015553, 22059152, 22065080, 22085529, 22125077, 22876838, 23000516, 23166678, 23190603, 23409016, 23448150, 23459592, 23536279, 23555046, 23708697, 23814263, 24048798, 24076665, 24243798, 24366691, 24423920, 24469053, 24658109, 24691646, 24792437, 24867100, 25048528, 25213694, 25256166, 25316808, 25501279, 25823028, 26339347, 26948367, 27176780, 27196759, 27448972, 27533080, 27553832, 28147244, 28332226, 28379424, 28423515, 28471660, 28576488, 28592260, 28696243, 28704425, 28834297, 28838997, 28958992, 29016844, 29016926, 29151909, 29184057, 29326882, 29328863, 29336479, 29434887, 29621542, 29729901, 29755294, 29768063, 29852183, 29977365, 30251117, 30281640, 30312846, 30333046, 30360807, 30371540, 30466783, 30506943, 30530503, 30535594, 30552990, 30662577, 30669284, 30669546, 30669581, 30715997, 30731398, 30796030, 30816477, 30877099, 30896873, 30898893, 30943748, 30943918, 31081099, 31151189, 31243804, 31247000, 31360067, 31360068, 31376551, 31416846, 31503386, 31541850, 31575848, 31618458, 31680298, 31698752, 31841506		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17513297, 19304958	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10958682, 12545160, 15605984, 16007122, 16849522, 17002787, 17050665, 17210246, 17616812, 18215105, 18260157, 18328427, 18566746, 19076776, 19461960, 19549905, 19633683, 20068170, 20169195, 20392929, 20473884, 20736378, 20857497, 20861085, 20888802, 21040711, 21063898, 21276823, 21430111, 21613208, 21827416, 21908773, 22015553, 22059152, 22065080, 22085529, 22125077, 22876838, 23000516, 23166678, 23190603, 23409016, 23448150, 23459592, 23536279, 23555046, 23708697, 23814263, 24048798, 24243798, 24366691, 24469053, 24658109, 24691646, 24792437, 24867100, 25048528, 25213694, 25256166, 25316808, 25431263, 25501279, 25501707, 25823028, 26339347, 26481529, 26948367, 27176780, 27196759, 27448972, 27498786, 27533080, 27553832, 27815359, 28147244, 28320338, 28332226, 28379424, 28423515, 28424411, 28471660, 28576488, 28592260, 28696243, 28704425, 28834297, 28838997, 28958992, 29016844, 29016926, 29151909, 29184057, 29326882, 29336479, 29434887, 29457830, 29729901, 29755294, 29768063, 29852183, 29977365, 30116397, 30251117, 30281640, 30312846, 30360807, 30371540, 30466783, 30506943, 30530503, 30535594, 30552990, 30662577, 30669284, 30669546, 30669581, 30700763, 30715997, 30731398, 30796030, 30816477, 30877099, 30896873, 30898893, 30943748, 30943918, 31081099, 31151189, 31214505, 31243804, 31247000, 31360067, 31360068, 31376551, 31416846, 31485609, 31503386, 31520357, 31541850, 31575848, 31618458, 31680298, 31698752, 31707687, 31841506		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	13130092, 17235455		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16170333, 17159987, 17804702, 18260157, 19214224, 19265662, 19549905, 19705067, 20116920, 20888802, 21057530, 21062993, 21480393, 21827416, 21996738, 22065080, 22079609, 22249269, 23459592, 23569237, 23690991, 24162827, 24741074, 24771584, 25351348, 25823655, 26034878, 26248734, 26342429, 27686608, 28212543, 28292440, 28332226, 28401302, 28410212, 28423515, 28608562, 28696243, 28881745, 28959975, 29207186, 29228741, 29324313, 29520611, 29535541, 29552118, 29572052, 29621055, 29718345, 29774498, 30296359, 30338804, 30372896, 30455394, 30542720, 30784920, 31002138, 31111534, 31173355, 31190861, 31240814, 31305291, 31324855, 31416846, 31680298, 31758290, 31776938, 31787462, 9446703		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29931616	Associate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	30818875		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29296277		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	28925480		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	25869207, 26080839, 27579615		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24840811		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	24697238		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	24641191		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	18774199, 19177005		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	17405772, 21361912		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28434922		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23619167, 23640975, 23847349, 24219320, 25995437, 26895469, 28197389, 28693263, 29284199, 29312563, 29440171, 29496059, 31597661, 31785230		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	17202264, 21276799, 29098623		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	12963636		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	14597618, 17404510, 17885560, 21631421, 28624424, 28904868, 29209026, 29574918, 30864233, 30974752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	39245801	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	12963636		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	30584986		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	23599148		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	11756194	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16645590, 19962457, 23380710, 23403624, 28112970, 28350342, 28592260, 28779993, 28802037, 29601991, 30067771, 30120858, 31032347, 31490009, 31601188, 31668943, 31741715		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	18317450, 30353642, 31698306		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	BEFREE	22729223, 23449172, 24853778, 28969385, 30687088		★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32050950	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	19584164, 30809316, 31541079		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	23537747		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	24913494, 25742482, 29107429, 30744607		★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	29449337		★☆☆☆☆ Found in Text Mining only
hereditary neuroblastoma	Neuroblastoma	BEFREE	28455243		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	19731079		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	30344716, 30796154		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	29626357		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	25377560, 29107666		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15289331, 17375124, 26549638, 27767172, 29615799, 30352904		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17375124		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19745829, 27466197, 31728850		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	31094678		★☆☆☆☆ Found in Text Mining only
Hyper-IgM Immunodeficiency Syndrome, Type 1	Hyper-IgM Immunodeficiency Syndrome	BEFREE	30319630		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	29719598		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17852837		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23316693, 27199286, 28391584, 28557977, 28666105, 29069833, 29108713, 29724723, 30051890, 30140011, 30362612, 30365051, 30584024, 30684218, 30945455, 31323977, 31583710, 31609623, 31612150		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29660344		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	14733908, 23316693, 28298335, 28557977, 28852804, 30708040, 30718284, 30770752, 31345231, 31467576		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29172017		★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	BEFREE	27550858		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	28843775		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16543958, 19299143, 22610309, 27834808, 28191736, 30584024, 30668312, 30686655, 30767203, 30934575		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	17404510		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	17404510		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	14981096, 19700418, 30200817		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29883676, 30920609		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	27885243		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30542605, 31069661, 31495205		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27581620, 39245801	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29138115, 31082354		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	26909593		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27087006, 27297622, 27667582, 28212825, 29956736, 30387816, 30753867, 31841211		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23439433, 23580232, 24276150, 28860768, 29563341, 30171960, 30602778, 30765508, 31335136		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	23439433	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	20485333, 27730700		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	15995708, 25573003, 26735698, 30813656, 31110302, 31538525		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19330021, 23251519, 29867948, 30474474		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22771711, 28342896, 28386360, 28584284, 28599877, 28656275, 28782464, 28859574, 29248560, 29290948, 29312496, 29516284, 29723552, 29916537, 29981363, 30086265, 30175975, 30787593, 30851305, 31004737, 31119777, 31254519, 31281447		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	30690033		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30385297		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	24233241, 24634376		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30288224		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17986714	Stimulate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	19549714		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28859574, 30061744		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29240250		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28087442, 28915718, 31746390		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	27207584, 28915718, 30387830, 31663655		★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	21590431		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	23935891		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30101479		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	26014518, 27655691, 28694672, 28902342		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	8732665		★☆☆☆☆ Found in Text Mining only
Irido-corneal dysgenesis	Anterior segment dysgenesis	BEFREE	28632845		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30693516, 30873034		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31272268		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26175178, 28395173, 28436420, 28587406, 28684048, 28978811, 29311781, 30362547, 30384445, 30797642, 30911000, 31132356, 31195053		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31589938, 31772637		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	24469048, 26457648, 27840422		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	28434922		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	19864499, 23708663, 30170375		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	25433273, 28033256, 30153510		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	29860458		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Keratoconus	Keratoconus	Pubtator	33729517	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Ketosis	Ketosis	BEFREE	30819264		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	25961698, 25987255		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30144073		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30176533		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28685413, 29049990, 30178867, 30387162, 30991714		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28765904, 29679000		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	19850877, 28938574		★☆☆☆☆ Found in Text Mining only
Kosaki overgrowth syndrome	Kosaki Overgrowth Syndrome	BEFREE	30941910		★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	29042286, 29336505		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26656176, 26883008, 27373675, 31545285		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	28002802, 30683135		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	12963636		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	17496901, 28002802, 30683135, 31753040		★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	LEOPARD Syndrome	BEFREE	20308328, 31798637		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16305491, 18684865, 19461960, 21436840, 21494257, 21789382, 22094587, 22477202, 23145067, 23180012, 23334668, 23832765, 24100660, 24244612, 24349524, 24484591, 24569456, 25299784, 26013878, 26194899, 26611474, 26974155, 27018341, 27673440, 27756877, 28716817, 28834761, 29179029, 29401696, 29844397, 29851132, 29927999, 30457982, 30649751, 30841886, 30972780, 31255635, 31412710		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17286201		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21449673	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	7691885		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16585200, 17215852, 17426258, 17928881, 18053070, 18184863, 18317450, 18548093, 18697750, 19148132, 20007139, 20193963, 20671809, 20884625, 21077741, 22613795, 22820502, 23263202, 23526884, 23535559, 23775716, 23919981, 23955073, 24383842, 25322685, 25426669, 25598437, 25823922, 25826077, 26044548, 26319392, 26465810, 26934650, 26999641, 27071307, 27174919, 28042875, 28350342, 28388564, 28418873, 28537457, 29143813, 29208365, 29276026, 29343273, 29442453, 29559471, 29889583, 30367526, 30472492, 30536332, 30710358, 30819918, 31053167, 31147526, 31240133		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	18830414, 29077243, 29688264		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	26023239, 30541897		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29108713, 29615799		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	28002802, 30683135		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19628422, 22240207, 23228846, 23806066, 29432993, 30352996, 30409306, 30519710, 31755615, 31831300		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	23810379		★☆☆☆☆ Found in Text Mining only
Lipomatosis	Lipomatosis	BEFREE	24374682		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple Symmetrical	Lipomatosis	BEFREE	24374682		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	24695632		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	28903316		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	22020193, 28637688		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11960367, 15795286, 16184552, 17145871, 17546603, 17557191, 18181165, 19591801, 20108172, 20430845, 20460918, 20473866, 20506537, 20860815, 21040406, 21102517, 21725613, 22155250, 22234835, 22360859, 22428038, 22552445, 22618716, 22957763, 23167739, 23474367, 23537747, 23588698, 23836295, 23910058, 23990456, 24048756, 24055031, 24223153, 24232099, 24347489, 24425104, 24556693, 24797434, 25060910, 25070581, 25091573, 25120782, 25280563, 25572981, 25633810, 25778319, 25826091, 26021873, 26044564, 26045065, 26055238, 26104578, 26160280, 26160430, 26249360, 26311153, 26884855, 26916922, 26992218, 27279530, 27602769, 27611696, 27628214, 27863926, 27918554, 27919945, 28018099, 28256185, 28442344, 28456666, 28464252, 28498423, 28586051, 28600143, 28680363, 28867187, 28901322, 28928809, 28968944, 28974422, 28977851, 28983625, 29213215, 29299170, 29312508, 29321577, 29337428, 29360358, 29449645, 29520149, 29530052, 29636997, 29680738, 29707960, 29721050, 29734164, 29737948, 29803224, 29864897, 29928334, 29940988, 29972254, 29992971, 30021391, 30025407, 30026540, 30067868, 30089483, 30231922, 30235011, 30312171, 30355923, 30418964, 30468465, 30473218, 30561038, 30582951, 30584322, 30588033, 30678274, 30696802, 30779474, 30796964, 30805927, 30971294, 30975125, 31033054, 31105864, 31148183, 31151404, 31281549, 31286509, 31313392, 31335281, 31377314, 31406464, 31410213, 31423276, 31439713, 31443247, 31481232, 31497229, 31499123, 31541003, 31541884, 31663122, 31668943, 31684995, 31694662, 31698037, 31698701, 31801250, 31802891, 31830378		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23894275, 24425104, 31060904		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	25080058		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28577493		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11960367, 15107404, 17557191, 23537747, 24048756, 24556693, 25826091, 27919945, 28692045, 28974422, 30975125		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12907143, 14695323, 20578176, 24374738, 24569456, 28693139		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22363436	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30348950		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39563449	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	14695357, 27665947, 29186690, 29501569		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28849060		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	21904903		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11908870, 18765521, 21502955, 22955914, 23300274, 23603894, 23721513, 23840064, 23921550, 25082755, 26350103, 26490423, 26503641, 28112970, 28147336, 28211162, 28945111, 29066507, 29765528, 30134175, 30333121, 30649751, 31110302, 31167506, 31250153, 31601188, 31619463		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	24799524, 28008149, 29179250, 30584024, 30813760, 30928169, 31200358		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23603894, 26823817, 27701018, 30096626		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	20133897, 31682844		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	11986952, 17654494		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	24705253, 24888723, 28086757, 28969385, 29883676, 30687088, 31056854, 31639285		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	BEFREE	26523971, 30687088		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	30717619, 30914203		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	23232578, 29487419		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	26479291		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	12084351, 16700623, 27553832, 28401302, 29069732, 31219215		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23619167, 23640975, 23847349, 24219320, 25995437, 26895469, 28197389, 28693263, 29284199, 29312563, 29440171, 29496059, 31597661, 31785230		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22116552, 23580240, 25082755, 26961147, 29961897, 30558987		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	BEFREE	31380420		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24491449		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	15837735, 24162827, 28556811, 29326882, 29718345, 31581005		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11507039, 11597319, 11706404, 12670921, 12866037, 12970748, 15001399, 15367412, 15472226, 15580312, 16168140, 16424042, 16582596, 16755107, 16951146, 17314276, 17452630, 17936563, 18498248, 18518979, 18652687, 18676830, 18725974, 19148520, 19238537, 19366795, 19395875, 19567590, 19584146, 19661335, 19685490, 19751211, 19881546, 19882362, 19946332, 20107891, 20112503, 20372866, 20424113, 20453058, 20471474, 20479250, 20480226, 20530877, 20538763, 20569503, 20664923, 20803067, 20940279, 21076301, 21127264, 21172654, 21209903, 21216892, 21278436, 21358673, 21362200, 21406469, 21420991, 21482677, 21676217, 21904903, 21932171, 21946274, 22049316, 22094188, 22114931, 22262199, 22266096, 22329846, 22370636, 22414288, 22488590, 22534171, 22710837, 22841774, 22915751, 22922893, 22952425, 22960556, 23065768, 23085752, 23089982, 23092874, 23184205, 23222510, 23301057, 23319441, 23343422, 23384338, 23389849, 23420345, 23448424, 23500535, 23612454, 23635776, 23643661, 23663564, 23665199, 23814023, 23888070, 23903756, 24001613, 24011769, 24121471, 24229379, 24269953, 24277465, 24356815, 24362250, 24403602, 24470511, 24493024, 24601221, 24706460, 24722917, 24836190, 24879796, 24981670, 24991009, 25002028, 25036402, 25056500, 25071141, 25127034, 25155268, 25199759, 25201346, 25355053, 25379017, 25401474, 25422220, 25458846, 25491778, 25542038, 25542856, 25544637, 25559818, 25566992, 25586125, 25692408, 25702787, 25801958, 25808869, 25816324, 25877889, 25961924, 25965974, 25979232, 26095475, 26116361, 26134759, 26148232, 26191181, 26194618, 26208487, 26215189, 26239613, 26260992, 26267533, 26289070, 26316702, 26452060, 26500061, 26515594, 26540293, 26595803, 26612860, 26643256, 26676464, 26681740, 26733612, 26758558, 26839307, 26840401, 26895380, 26921096, 26939876, 26945854, 26995633, 27004402, 27017286, 27048245, 27059323, 27088857, 27171498, 27197157, 27211281, 27221510, 27374081, 27402769, 27426307, 27553366, 27563827, 27573562, 27600857, 27604488, 27626181, 27639383, 27771839, 27803006, 27848885, 27864123, 27940576, 28060760, 28123607, 28160548, 28165066, 28176176, 28196852, 28216025, 28228253, 28231748, 28276317, 28296140, 28296189, 28336670, 28381172, 28382169, 28383549, 28396358, 28407679, 28418910, 28423632, 28446508, 28454214, 28459209, 28486103, 28495456, 28498520, 28513879, 28518139, 28533273, 28539475, 28576675, 28599470, 28600142, 28750640, 28756150, 28779263, 28791358, 28791363, 28810530, 28854595, 28856747, 28861172, 28881779, 28902361, 28910567, 28915591, 28923573, 28929029, 28969041, 28991258, 29086897, 29103666, 29107429, 29110152, 29127189, 29128895, 29130495, 29169282, 29252036, 29259101, 29262587, 29310608, 29316252, 29345357, 29355544, 29399197, 29430197, 29482551, 29504069, 29524295, 29545474, 29550144, 29550515, 29568883, 29574068, 29599830, 29636477, 29689598, 29700210, 29715106, 29721370, 29725474, 29736694, 29737572, 29774109, 29791862, 29792310, 29808803, 29844859, 29851245, 29863252, 29906308, 29925528, 29928143, 29942081, 29942710, 29951132, 30038508, 30038517, 30038706, 30076411, 30078647, 30103105, 30126855, 30148117, 30207362, 30212931, 30220978, 30266800, 30272349, 30287915, 30315845, 30318472, 30357946, 30368861, 30454896, 30483746, 30515357, 30515835, 30518672, 30540926, 30542378, 30543347, 30578411, 30628639, 30652303, 30662797, 30671946, 30678711, 30737233, 30767161, 30796030, 30820547, 30873673, 30880072, 30898150, 30903140, 30930461, 30943409, 31005809, 31006103, 31018950, 31104012, 31124219, 31142739, 31159599, 31173106, 31195751, 31235687, 31256368, 31257479, 31277699, 31313132, 31317673, 31320990, 31322299, 31359335, 31391067, 31408722, 31417306, 31417861, 31448883, 31464004, 31539632, 31552922, 31636652, 31660072, 31660083, 31683659, 31688991, 31696760, 31710162, 31751581, 31761784, 31786856, 31787861, 31798622, 31822498, 31824171, 31828441		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15067356, 16273242, 17924977, 19261849, 19917135, 20664599, 21687953, 21984976, 22075757, 22146979, 22662154, 23028188, 23235274, 23538402, 23674493, 23702729, 24561032, 24651628, 25141911, 25624430, 26045339, 26193427, 27259051, 27613818, 28002804, 28119489, 28202507, 28860563, 28886696, 28945226, 29081412, 29182407, 29426295, 29854314, 30104481, 30338797, 30402135, 30569174, 30574817, 30779215, 30853360, 31176047, 31233196, 31486482, 31588998		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16380997, 17638919, 18262558, 19164214, 25435423, 27239113, 28109079, 28384037, 28867195, 29285246, 29456742, 29604392, 30368517, 30636576, 30942438, 31091245, 31785047		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25623055, 26947513, 28656003, 28766687, 29416013, 30276551		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	16220453, 22543857		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17362927, 19850877, 30288056, 30840265, 31007884		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	27373675, 29085504, 29299828, 29312563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20197465, 24482231, 26375440, 28364599, 29636773, 29658568, 29940988, 30779474, 30840267, 31312391, 31357893, 31439713, 31638175, 31642074, 31673889		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12714585, 19337377, 19850869, 20375364, 20596634, 20811722, 20818420, 20959404, 21220474, 21688263, 21861134, 21996732, 22363436, 22941571, 23045273, 23111416, 23172887, 23454899, 23728071, 23955080, 24085243, 24229705, 24469108, 24472538, 24533074, 24675361, 24788552, 24972969, 25266803, 25524703, 25573345, 25673697, 25738369, 25861627, 26013318, 26176612, 26517240, 26645682, 26667343, 27041574, 27121230, 27177359, 27221310, 27881463, 27930981, 28108151, 28125432, 28173828, 28259980, 28336809, 28356026, 28662101, 28748356, 28782471, 28847905, 28901268, 29115573, 29132432, 29171984, 29269744, 29328421, 29504919, 29508110, 29516506, 29616103, 29620222, 29669316, 29864375, 29961813, 30058690, 30190703, 30344755, 30365050, 30431081, 30481052, 30590030, 30779080, 30787353, 30806240, 30825612, 30896825, 31115514, 31128006, 31158500, 31262325, 31337981, 31452780, 31748336		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	22240207, 23228846, 23806066, 29432993, 30352996, 30409306, 30519710, 31755615, 31831300		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	18789327, 24041865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	30185662		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11531284, 11706404, 16452192, 16545436, 17178867, 18270270, 19029838, 19638206, 21317880, 21372221, 21970855, 22094188, 22340595, 22585163, 22876838, 23371322, 23408974, 23591839, 23970345, 24011934, 24022196, 24036443, 24115647, 24247248, 25216292, 25677064, 25852062, 26159849, 26657155, 26909613, 26983899, 27082164, 27840916, 28574782, 28848242, 29113199, 29371953, 29401696, 29743815, 29909423, 29930760, 30129654, 30237504, 30245957, 30630630, 30755818, 30925458, 30972187, 31128298, 31284467, 31638241, 31731647, 31752654		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12535639, 15837735, 15851011, 17043657, 19405118, 20686216, 20807812, 21678117, 22170433, 22248802, 22509328, 22902833, 22952903, 23589145, 25152578, 25285629, 25376606, 26451606, 27176210, 27179037, 27220401, 27339327, 27426724, 27845911, 28000865, 28176634, 28320094, 28360038, 28442920, 28574828, 28583586, 29204055, 29348875, 29434912, 29880482, 29898401, 29901184, 30046371, 30243721, 30323973, 30396902, 30464602, 30506130, 30536312, 30555743, 30575903, 30738116, 31088502, 31128031, 31153980, 31391551, 31531884, 31631174, 31649109, 31683659		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	29662627, 29902261		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15788644, 16061480, 16328002, 16425184, 16651432, 17551921, 17826033, 18615538, 18942118, 19099539, 19275762, 19443396, 19633975, 19787273, 20019190, 20197460, 20203370, 20231295, 20530556, 20940396, 21138868, 21310825, 21575859, 22491797, 22509301, 23171135, 23434594, 23585456, 23765843, 23798432, 24067903, 24163230, 24204196, 24294372, 24339862, 24652480, 24830689, 24831963, 24866151, 24972028, 24983969, 24991009, 25026288, 25120209, 25139413, 25275598, 25636507, 25640606, 25707690, 25799167, 25829425, 26124442, 26143945, 26261538, 26544944, 26577921, 26909613, 26986507, 27324222, 27357679, 27375016, 27426307, 27431052, 27470558, 27557496, 27588482, 27821815, 27966458, 27995550, 28061438, 28123608, 28212321, 28225015, 28314838, 28319045, 28350865, 28420128, 28422286, 28442344, 28631436, 28676490, 28915623, 28977864, 29133261, 29141866, 29181846, 29316844, 29328471, 29330287, 29453322, 29581176, 29730477, 29767248, 29792732, 29963230, 30012673, 30045927, 30132513, 30133757, 30139961, 30142541, 30194716, 30208576, 30300679, 30320903, 30379590, 30382885, 30483810, 30581390, 30733525, 30813597, 30854108, 30973040, 31016228, 31092266, 31228307, 31296553, 31345230, 31551414, 31726118, 31814446		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31370278		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15809724, 16627973, 19143835, 20954287, 21406037, 21841827, 22292935, 22334453, 22543857, 22799764, 22876838, 23058013, 23326131, 23661031, 23743572, 23813545, 23960014, 24068565, 24276243, 24458107, 24726064, 24837198, 25015565, 25400827, 25613482, 25701378, 25727320, 25914465, 26201869, 26330014, 26398764, 26543351, 26604635, 26701847, 27006499, 27121204, 27156070, 27470388, 27712585, 28260026, 28550907, 28588255, 28608528, 28671020, 28950928, 29069734, 29106389, 29208564, 29212166, 29243780, 29257342, 29278851, 29282102, 29332342, 29374144, 29422964, 29422968, 29450946, 29522284, 29700210, 29767248, 29767389, 29802999, 29867504, 29872314, 29917165, 29949784, 30089248, 30134988, 30138931, 30176223, 30275715, 30302796, 30320337, 30344716, 30349304, 30389134, 30628706, 30632400, 30720166, 30793479, 30796154, 30816492, 30953349, 31207155, 31243897, 31297980, 31339445, 31352788, 31497207, 31527621, 31692102, 31713929, 31732769, 31737204, 31786865, 31816819, 31819646		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	15928251, 17317825, 17545635, 17891251, 18502332, 19638576, 19706758, 19907326, 20578891, 21289267, 21878896, 23128507, 24098937, 24781864, 26265449, 26456083, 26472282, 27258970, 28042956, 28600475, 29055016, 29163356, 29236327, 29272787, 29301825, 29353884, 29969438, 30365150, 30699064, 31285773, 31289610, 31727500		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	30128883, 31788102		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19789314, 19875696, 20354165, 22285928, 22895070, 22906492, 23224295, 23300058, 24347284, 24442130, 24929024, 24952510, 25349966, 25812440, 26312564, 26597249, 27726892, 27823983, 28647190, 28808038, 28889395, 29070760, 29190973, 29357370, 29383014, 29670371, 29725263, 29749527, 30845932, 30941989, 31298367, 31527329, 31605287, 31692549, 31696468		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11357143, 11606375, 11756194, 12670921, 12714585, 15183529, 15254063, 15289331, 15608670, 15763568, 15784156, 15788644, 15805248, 16096426, 16220453, 16274621, 16317585, 16322209, 16331247, 16341064, 16341083, 16357568, 16364744, 16432179, 16772787, 16861905, 16917505, 17018259, 17050665, 17310986, 17371230, 17409395, 17427168, 17471559, 17483325, 17502453, 17561399, 17568777, 17626883, 17669465, 17924977, 17928881, 17964232, 18059185, 18208370, 18270270, 18281460, 18385752, 18420279, 18473732, 18492751, 18676830, 18712679, 18794884, 18829560, 18830414, 19076776, 19110052, 19185485, 19261849, 19279572, 19299143, 19305146, 19342374, 19363621, 19389506, 19420344, 19435890, 19491896, 19573809, 19589091, 19591801, 19602588, 19625770, 19639178, 19713247, 19729658, 19751211, 19789314, 19789349, 19805051, 19850869, 19875696, 19891769, 19962660, 19963098, 20007139, 20022634, 20039471, 20130907, 20179189, 20381234, 20392999, 20404174, 20409325, 20414202, 20436278, 20522531, 20530683, 20535651, 20541701, 20551061, 20551944, 20578891, 20582532, 20671809, 20713702, 20803067, 20844931, 20876794, 20937558, 20956547, 21113138, 21278436, 21395485, 21398405, 21422497, 21494810, 21519185, 21551261, 21558396, 21713600, 21743495, 21775521, 21788516, 21822287, 21893191, 21909130, 21910030, 21912691, 21946274, 21996737, 22006429, 22020336, 22110663, 22120709, 22159814, 22221675, 22239433, 22271473, 22307544, 22410782, 22414288, 22443084, 22453015, 22477202, 22491797, 22543588, 22545132, 22553088, 22570710, 22647622, 22729222, 22835386, 22860766, 22872574, 22876838, 22898541, 22912864, 22936352, 22973958, 22983389, 23038273, 23058013, 23085539, 23112296, 23160481, 23166678, 23215719, 23232578, 23292285, 23300274, 23313199, 23319332, 23321674, 23354733, 23376645, 23408974, 23436801, 23437041, 23437382, 23438828, 23453624, 23483710, 23526884, 23532336, 23548265, 23551097, 23565202, 23588698, 23635776, 23642907, 23705826, 23708663, 23728071, 23783557, 23812635, 23867565, 23873848, 23948751, 23960014, 23986086, 24077346, 24085243, 24088382, 24204196, 24231454, 24240591, 24244612, 24248467, 24265156, 24269953, 24304721, 24356998, 24368110, 24374682, 24385586, 24459181, 24479804, 24561792, 24569712, 24576621, 24614719, 24631838, 24648465, 24686850, 24737887, 24769729, 24837077, 24897931, 24913553, 24969680, 24979463, 24991009, 25072857, 25082755, 25096023, 25109960, 25126847, 25130770, 25141911, 25215588, 25275598, 25301678, 25351625, 25376370, 25422220, 25550458, 25554016, 25557115, 25569743, 25573003, 25613482, 25684140, 25688137, 25707690, 25771729, 25813410, 25823655, 25833940, 25837824, 25850957, 25865774, 25883022, 25962115, 25964548, 25982275, 25995437, 26003731, 26044548, 26045339, 26080840, 26082006, 26104578, 26116360, 26124442, 26138515, 26176612, 26181206, 26208882, 26224641, 26224873, 26261538, 26289070, 26460954, 26472282, 26490311, 26549034, 26604635, 26627007, 26633882, 26645663, 26658520, 26722535, 26733612, 26748241, 26796526, 26880266, 26921096, 26934321, 26947513, 26974310, 27035903, 27048952, 27059323, 27156070, 27163202, 27176210, 27179037, 27191687, 27196759, 27197157, 27292631, 27339942, 27342398, 27388585, 27393705, 27420608, 27422710, 27426307, 27468760, 27470558, 27489353, 27503199, 27542768, 27582428, 27582570, 27589564, 27589846, 27590631, 27604488, 27612668, 27626684, 27628214, 27642729, 27658642, 27680505, 27756837, 27779650, 27793898, 27870715, 27881235, 27935819, 27940576, 27941887, 27980108, 27989859, 28003307, 28054203, 28059163, 28061797, 28082369, 28087713, 28108151, 28109945, 28112970, 28131786, 28132115, 28146265, 28176240, 28205653, 28224609, 28228253, 28249908, 28273837, 28276440, 28287114, 28315368, 28322787, 28343126, 28350104, 28356026, 28357727, 28367561, 28373445, 28376174, 28379898, 28386017, 28388280, 28396358, 28409639, 28423632, 28435223, 28447797, 28467889, 28468801, 28476657, 28506751, 28515318, 28532501, 28550454, 28554019, 28583586, 28594589, 28615225, 28619980, 28619981, 28630349, 28637688, 28640835, 28652248, 28655764, 28666866, 28677816, 28693263, 28713374, 28718419, 28743532, 28758175, 28800461, 28802037, 28806782, 28808038, 28808415, 28814887, 28838997, 28842968, 28851839, 28853539, 28857471, 28859574, 28877984, 28889395, 28923280, 28963139, 28969535, 29055016, 29061642, 29068474, 29074462, 29086897, 29097657, 29107429, 29115462, 29127587, 29145206, 29150437, 29156674, 29170395, 29179250, 29190313, 29200870, 29219001, 29238073, 29246942, 29279775, 29284706, 29286307, 29296217, 29326691, 29326882, 29343273, 29348263, 29348577, 29357370, 29358688, 29374181, 29397960, 29408410, 29408858, 29410116, 29424321, 29435055, 29440171, 29456661, 29470683, 29472518, 29490947, 29506489, 29508857, 29522278, 29535720, 29558998, 29559471, 29563327, 29567475, 29568394, 29568883, 29572236, 29616047, 29621663, 29670543, 29674246, 29706964, 29716938, 29719293, 29729098, 29743718, 29760043, 29799306, 29844859, 29851132, 29862966, 29868481, 29925528, 29928328, 29940988, 29980517, 29991713, 30008846, 30018141, 30026672, 30030980, 30038340, 30147333, 30150413, 30174412, 30190422, 30190795, 30191811, 30197175, 30217221, 30221743, 30226540, 30257389, 30269363, 30300952, 30321514, 30333046, 30388053, 30406111, 30410397, 30429249, 30442683, 30498491, 30499396, 30519710, 30533316, 30552990, 30565691, 30574817, 30576338, 30577600, 30582752, 30592328, 30602575, 30620381, 30649751, 30675261, 30679179, 30683135, 30710631, 30714617, 30717619, 30718284, 30742905, 30755818, 30774762, 30782187, 30813656, 30832253, 30843693, 30849534, 30855339, 30866419, 30877085, 30881282, 30881494, 30883028, 30922959, 30927432, 30942405, 30948643, 30951826, 30952707, 30971889, 30971929, 30979616, 30982497, 30999672, 31025080, 31032340, 31036418, 31059051, 31072323, 31106493, 31127138, 31131274, 31185594, 31187710, 31188922, 31209687, 31215384, 31234823, 31235839, 31244112, 31247018, 31250153, 31251469, 31319350, 31323288, 31359259, 31366089, 31374965, 31393501, 31408676, 31417861, 31461270, 31461863, 31477842, 31478386, 31492635, 31545285, 31545473, 31558467, 31560953, 31581005, 31585260, 31596728, 31601147, 31618458, 31620236, 31626273, 31632439, 31634770, 31638167, 31665227, 31668943, 31678210, 31686003, 31692035, 31705880, 31717544, 31741715, 31751567, 31752127, 31753040, 31766246, 31772118, 31788078, 31792765, 31801949, 31812693, 31830561, 31831213, 31831562, 31846325		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	31092379		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	23607916, 28945300		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20657188, 22229477, 22235101, 23899375, 25135429, 25310288, 25738254, 25962638, 26183061, 26802646, 27388585, 28036259, 28475243, 29175387, 29236322, 29312623, 29316891, 29328485, 29423104, 29777148, 29898430, 30006571, 30127216, 30272334, 30459531, 30480801, 30552693, 30619121, 30641218, 31056260, 31210294, 31295843, 31545455		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10625637, 10972292, 11756194, 12473596, 16153452, 16772787, 17575153, 18064605, 18224685, 18627290, 19572978, 20204404, 22543857, 23251002, 23593290, 23633456, 23708654, 24398569, 24756222, 24930890, 25199763, 25314071, 25554016, 25732087, 26225471, 26615871, 28259918, 28432271, 28782499, 28811711, 28881576, 28979133, 29130099, 29305742, 29523145, 29560517, 30023564, 30195873, 30257389, 30396937, 30551398, 30941956, 31500630, 31510692, 31596728		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30716082		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15625017, 18167534, 18284215, 20530877, 20569503, 20591134, 20712882, 21512767, 22640628, 23999432, 24147022, 26500061, 27088857, 27484095, 28176176, 28929029, 29143998, 29472518, 29486734, 29719270, 29880805, 30042442, 30420699, 30692633, 31139940, 31219154, 31391067, 31532771		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17515959, 18625725, 18652687, 18725974		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	27789311		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16645163, 17606765, 22107151, 22116552, 23341541, 23580240, 23676220, 24273091, 25082755, 26549638, 26961147, 27894215, 28533307, 29961897, 30558987, 30701029		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	31807935		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	17375124		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17188151, 23934677, 26081844		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	16398471, 16707597, 18281460, 21652733, 23455179, 24584142, 25601471, 25915540, 28035748, 28159923, 29377550, 29682173, 29805559, 30050750, 31492956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	CTD_human_DG	21652733		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	21652733	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	21652733		★☆☆☆☆ Found in Text Mining only
Megalencephaly cutis marmorata telangiectatica congenita	Megalencephaly Cutis Marmorata Telangiectatica Congenita	BEFREE	31729162		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16273242, 16470169, 17039502, 17318262, 17388918, 17492934, 18323781, 19342374, 19810100, 22417301, 22453015, 22549727, 22693259, 22808163, 22912864, 23039341, 23077590, 23112250, 23246970, 23355370, 23383069, 23431193, 23443536, 23444215, 23554059, 24133630, 24178756, 24200692, 24201813, 24258993, 24288008, 24313465, 24600206, 24803579, 24812408, 24890688, 24920406, 25165098, 25168062, 25472943, 25627962, 25712345, 25848750, 26356562, 26509654, 26577700, 26640950, 26678033, 26884185, 27017286, 27196754, 27248171, 27999416, 28064546, 28092667, 28233937, 28368422, 28380455, 28543695, 28774796, 29210065, 29532857, 29969627, 29975213, 29980517, 29990500, 30237495, 30325319, 30340844, 30385854, 30613786, 30793515, 30854129, 31048499, 31138602, 31413145, 31599425, 31788081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	18722093		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	32891176	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	21652733		★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	30127118		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23285163, 25998419, 26826201, 27550858, 28610844, 29424888, 31077268		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27483380, 30063009, 30105773, 31353678, 31491407, 31618892, 31770536		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	29976496		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	22261808, 22363598, 26536665, 30038704, 30073632		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	18511708, 22019695, 24419422, 30582752		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	31752449	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	31345368		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23551103, 30266989		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24555840, 24784704, 27766312, 29044143, 30288995, 31512260		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	19047166, 22912864, 25168062, 26790143, 28921907, 31115969, 31470659, 31586634		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	16288293, 19903888, 29858226, 31296553		★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	30787173		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28791398		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31849586		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	28623977		★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	30061365		★☆☆☆☆ Found in Text Mining only
Mobius Syndrome	Mobius syndrome	Pubtator	31033088	Associate	★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	28459375		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29250741, 9857977		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	17303436		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	23708654		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	30282066		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	22266152		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	23840053		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12149650, 13679867, 20022634, 20505158, 21475253, 22415553, 22955917, 22985491, 23185517, 23318440, 25060991, 25197055, 25369735, 25422161, 25837824, 25915427, 27144172, 27439454, 27559096, 27626482, 27686868, 28282033, 28350342, 28512269, 28977849, 29254208, 29322846, 29963125, 30132507, 30338809, 30401630, 30664164, 30712673, 30787971, 30867372, 31148590, 31284669, 31498483, 31564190, 31571328		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24412596, 27890794, 29492193, 29847724, 31212712		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22351695, 27988397, 29749435		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	23382981, 23445613		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11756194, 24569456		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15833859, 16291747, 18184863, 18644865, 19357699, 21288887, 21596859, 23180012, 24603487, 24806995, 25644089, 25837664, 25855199, 26722450, 27018341, 27875938, 28069548, 28435223, 28986256, 29549929, 29710665, 29762880, 30185934, 30796703, 31097376, 31515296		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	16291747		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	21907926, 23445613, 23748344, 24237791, 24251790, 24290217		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	12963636		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17172449, 17225869, 20056919, 25936391, 28115595, 28453729, 29276114, 29424913, 30017933, 30323868, 30487059, 30679990, 30905784, 31169981, 31313516, 31599782		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	25787015, 29658565, 29689553, 30402501, 31082728, 31120192, 31297863, 31377586		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	30721303		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	22020193, 28637688		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	22306204		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18202777, 18452707, 18789327, 19012001, 19276680, 20927779, 23681229, 24041865, 25126743, 25351620, 26568302, 26581613, 27876891, 28586035, 28720063, 29409973, 29491062, 29525743, 29636781, 29693120, 29789630, 29882205, 29936709, 29963130, 29973197, 30374682, 30402158, 30403591, 30459351, 30582216, 30651769, 30834525, 30936832, 30944308, 30982497, 31328403, 31334669, 31383854, 31403940, 31408612, 31521748, 31598395		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29545879		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10749120, 10972292, 11071655, 11359902, 11401316, 11585776, 11706404, 11803474, 12149650, 12430714, 12435856, 12535639, 12548599, 14555504, 14597629, 14603260, 14605666, 14655756, 15282551, 15342383, 15342917, 15361839, 15548710, 15591514, 15605984, 15784156, 15809724, 15837735, 15851011, 16115952, 16162974, 16184552, 16267002, 16286246, 16322209, 16380997, 16461335, 16618740, 16645045, 16651432, 16772787, 16775835, 16912159, 16912192, 16917505, 17013611, 17188151, 17218472, 17314276, 17405772, 17427168, 17468516, 17546603, 17549376, 17551921, 17559806, 17561399, 17826033, 17924977, 17942896, 17954274, 17964232, 18059185, 18180098, 18248818, 18339867, 18474617, 18511708, 18541712, 18558293, 18587247, 18622646, 18641990, 18676830, 18725974, 18755892, 18794877, 18794884, 18829560, 19029838, 19047166, 19080742, 19095950, 19110052, 19117997, 19205734, 19275762, 19279572, 19304958, 19321861, 19372546, 19384955, 19395652, 19407556, 19411062, 19411071, 19420344, 19435890, 19435893, 19437103, 19487288, 19492075, 19509163, 19588205, 19685490, 19731079, 19805051, 19810100, 19850869, 19963098, 20014924, 20107891, 20116920, 20407443, 20479250, 20551061, 20591134, 20610278, 20664988, 20736378, 20803067, 20940396, 20951698, 21045147, 21196179, 21273607, 21321202, 21355080, 21362200, 21388951, 21397855, 21430697, 21454687, 21482676, 21490305, 21494810, 21519185, 21538561, 21558396, 21618540, 21676217, 21720709, 21725613, 21793738, 21822287, 21903247, 21966435, 21980390, 21984975, 21996737, 21996738, 22045983, 22059152, 22075556, 22082146, 22107151, 22126964, 22135231, 22213219, 22301702, 22340730, 22363436, 22370636, 22392911, 22411898, 22475322, 22481496, 22493273, 22496919, 22505453, 22532600, 22549727, 22609107, 22684718, 22692904, 22777351, 22821509, 22847424, 22897848, 22906543, 22911820, 22912864, 22915751, 22915752, 22952903, 22971992, 22973958, 22983922, 23030486, 23065523, 23077590, 23086777, 23117887, 23160634, 23171135, 23172887, 23184205, 23211222, 23228846, 23239809, 23258740, 23261230, 23296808, 23319441, 23319822, 23332287, 23343422, 23408974, 23409016, 23443536, 23444215, 23500101, 23509792, 23555892, 23565202, 23582881, 23588386, 23593290, 23599148, 23619167, 23629727, 23640975, 23650412, 23667466, 23674493, 23676220, 23676460, 23679233, 23685749, 23699387, 23705826, 23708654, 23743567, 23743572, 23744781, 23764004, 23826249, 23837763, 23899375, 23921550, 23945331, 23948973, 23976985, 23986086, 23990456, 23999432, 24031087, 24040255, 24043760, 24048331, 24076665, 24098937, 24136889, 24166148, 24168180, 24170767, 24200692, 24240111, 24284056, 24288008, 24291216, 24316979, 24322983, 24323026, 24393708, 24395457, 24420152, 24436048, 24447333, 24451154, 24467951, 24469055, 24504677, 24518503, 24533074, 24554201, 24582960, 24601221, 24606897, 24610641, 24619078, 24634413, 24648465, 24708766, 24746758, 24789658, 24797434, 24803579, 24828662, 24837198, 24840574, 24879796, 24897931, 24920549, 24947930, 24979463, 24984002, 24986896, 24991009, 25002028, 25015834, 25017791, 25070358, 25071014, 25103565, 25109960, 25245477, 25266798, 25267489, 25330188, 25361917, 25376606, 25381262, 25450577, 25451255, 25461771, 25482044, 25547910, 25554016, 25596284, 25622909, 25636507, 25640278, 25677064, 25712345, 25712460, 25714556, 25724520, 25742786, 25749378, 25749388, 25762617, 25839328, 25868852, 25877889, 25877892, 25889301, 25908046, 25913740, 25929848, 25962638, 25982275, 25995437, 25998419, 26001593, 26045339, 26070568, 26082006, 26148232, 26158412, 26160280, 26224681, 26267533, 26276352, 26279473, 26299806, 26354852, 26432405, 26472282, 26517521, 26536665, 26549638, 26573229, 26577921, 26617744, 26617767, 26766736, 26823817, 26824764, 26887047, 26902599, 26909613, 26974310, 27012708, 27017286, 27048952, 27057633, 27082119, 27088857, 27130196, 27137076, 27179037, 27184134, 27196754, 27211281, 27270588, 27375016, 27435399, 27465249, 27470558, 27484095, 27510461, 27528625, 27572273, 27582428, 27582570, 27611696, 27642729, 27748285, 27765922, 27791012, 27797976, 27803006, 27807828, 27811202, 27848885, 27863432, 27889608, 27903677, 27926496, 27930981, 27940576, 27960601, 27986750, 28002802, 28002804, 28003307, 28071763, 28087713, 28093061, 28132399, 28143957, 28153863, 28173828, 28184015, 28206962, 28228253, 28232476, 28252027, 28273837, 28275119, 28280276, 28281183, 28286604, 28327999, 28331003, 28348046, 28350098, 28351943, 28378642, 28380455, 28384037, 28404374, 28415744, 28454214, 28459375, 28482067, 28522609, 28532501, 28537878, 28545028, 28551845, 28561737, 28576675, 28592260, 28598238, 28603282, 28630349, 28631436, 28637905, 28640835, 28648934, 28662101, 28687441, 28688971, 28710365, 28716817, 28723560, 28730764, 28750640, 28765120, 28775144, 28776573, 28783168, 28808038, 28811223, 28829592, 28848242, 28860342, 28881576, 28891094, 28923280, 28945226, 28963139, 28969535, 29040676, 29042961, 29052531, 29055016, 29080392, 29081412, 29084199, 29085498, 29125886, 29133593, 29156674, 29170395, 29175105, 29180042, 29184057, 29219001, 29238073, 29246942, 29279775, 29286307, 29312623, 29316844, 29331750, 29348263, 29348486, 29392777, 29407971, 29408595, 29432993, 29433740, 29434887, 29435055, 29440171, 29455665, 29460925, 29467326, 29470683, 29477378, 29487419, 29540490, 29549127, 29550515, 29552226, 29552308, 29562639, 29562961, 29572236, 29598951, 29636477, 29685880, 29687840, 29695638, 29729098, 29748541, 29760043, 29760047, 29763625, 29776351, 29844397, 29848992, 29849718, 29868481, 29901097, 29911928, 29924958, 29942710, 29952249, 29959202, 29970482, 29985991, 30076862, 30093452, 30097489, 30133757, 30139984, 30160115, 30195142, 30237495, 30237504, 30246429, 30275715, 30289966, 30302796, 30333046, 30333121, 30343258, 30344716, 30352904, 30368517, 30391357, 30399177, 30474474, 30483746, 30483877, 30506278, 30506943, 30519710, 30544563, 30551398, 30556851, 30582752, 30587236, 30590030, 30591513, 30603906, 30610794, 30636581, 30655739, 30689149, 30705430, 30710631, 30718284, 30720124, 30722993, 30733438, 30770351, 30782187, 30782609, 30789971, 30841886, 30867161, 30867372, 30867772, 30894372, 30925702, 30930461, 30942405, 30942438, 30981504, 30991262, 30999672, 31016228, 31018249, 31018997, 31024258, 31057104, 31074594, 31115571, 31230505, 31258788, 31262325, 31328403, 31349748, 31360067, 31360068, 31374965, 31380170, 31391067, 31391455, 31414579, 31427284, 31433956, 31453054, 31492635, 31516747, 31531063, 31541884, 31541887, 31545453, 31548239, 31551414, 31570656, 31591478, 31597912, 31603993, 31617074, 31619463, 31636720, 31656319, 31663655, 31678210, 31692549, 31785230, 31822716, 31823159, 31832114, 31832711, 31848194, 9446703		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	28486691, 30018387		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	21361912		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	18511807, 28322459, 30338213, 30649196		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	LHGDN	18511807		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30144073		★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	30210600		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30210600		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29867948, 30567315, 31133639		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	22821509, 25217104, 25245477		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12438236, 12485836, 15065019, 15882878, 16769337, 16778834, 16912192, 18026138, 18278068, 18973553, 19211844, 20811723, 21225506, 21355080, 23232578, 23378341, 23468863, 24026661, 25134527, 25228590, 25622909, 26224681, 26432405, 26687764, 27278249, 27533468, 27649927, 28840510, 28881723, 28919254, 29137381, 29204750, 29352113, 29398519, 29499203, 30722993, 31150649, 31310053, 31638167, 31704096		★☆☆☆☆ Found in Text Mining only
Neurocutaneous Syndromes	Neurocutaneous Syndromes	BEFREE	26706010, 28265819		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21195169, 28383489, 28495385, 29650257, 29965873, 30154448, 30611996, 30707354, 30922159, 31639492		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31211828		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	23455179, 31261148		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	19917848, 22499437, 25441311, 26087898, 26978006, 27355335, 27513674, 28344663, 29146887, 30588264		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	16461335, 17053831, 22544507, 25092287, 28534510		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	28468780		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	31461843		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31849648		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30090490		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	29108713, 29615799		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	18835245		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28146130, 28905319, 29172017, 29228666, 29350678, 29990865, 30484310, 30805986, 31187710, 31551937, 31796646		★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	31832114		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12714585, 15526754, 16003751, 16115952, 16909043, 19553005, 20026060, 20866043, 21325072, 21421804, 21688263, 21861134, 22037177, 22247021, 22363436, 22489661, 22522453, 22901187, 23270470, 23332287, 23454899, 23625155, 23728071, 24055012, 24133589, 24389182, 24471765, 24533074, 24550137, 24662916, 24675361, 24804226, 24946933, 24972969, 24983493, 25122774, 25304988, 25341405, 25691296, 25746385, 26019170, 26053643, 26061184, 26108998, 26149216, 26176612, 26203858, 26339598, 26555006, 26802652, 26919096, 27082424, 27121230, 27236384, 27248324, 27748834, 27765909, 27815359, 27880728, 27930974, 28093061, 28167505, 28210267, 28293123, 28378642, 28404902, 28423589, 28459375, 28477368, 28534966, 28662101, 28713974, 28715819, 28797845, 28901419, 28992562, 29207097, 29208568, 29328421, 29345289, 29362431, 29374181, 29387228, 29393481, 29436654, 29524402, 29526543, 29552215, 29556279, 29558998, 29669316, 29731854, 29762835, 29767245, 29803922, 29896260, 29901139, 29928341, 30066933, 30087612, 30098066, 30125547, 30145802, 30226581, 30290307, 30310502, 30381967, 30393483, 30420490, 30450569, 30478628, 30496626, 30535430, 30542737, 30640793, 30779077, 30797236, 30825612, 30854106, 30889481, 30896825, 30941980, 30942425, 30991262, 31024010, 31055884, 31074594, 31085700, 31105808, 31114247, 31123168, 31190892, 31213835, 31262325, 31262731, 31310954, 31360122, 31421833, 31444970, 31485626, 31497240, 31521695, 31681988, 31762810, 31802909, 31823159		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28194671		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	23500535, 24634376, 27581127		★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	BEFREE	26138515		★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	BEFREE	27980108		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20107106, 21082206, 23551103, 23688012, 24333006, 28351943, 28720716, 28842968, 28904022, 29574066, 29724723, 30263000, 30528731, 30563932, 30922122, 30948720, 31497027, 31502860		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	19366795, 19435893, 19609946, 20569503, 21362200, 21420991, 22096658, 23301057, 24520381, 25158023, 25491778, 26733612, 28910567, 29127189, 29252036, 29507656, 29686231, 30315845, 31221824, 31391067, 31439579		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	30975663		★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	30184529		★☆☆☆☆ Found in Text Mining only
Opsoclonus-Myoclonus Syndrome	Opsoclonus-myoclonus syndrome	BEFREE	30718793		★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Optic Nerve Glioma	BEFREE	25534823		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	24341335, 30185662		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31777535		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	27601172, 29257253, 30186461, 30550742, 31250662		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28880271, 29710518		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27756897, 28408345, 29115382, 29571022, 30221712, 31389578		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	29158773, 30735778, 31301305, 31611520		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22006429, 23202914, 23208072, 23372675, 24366211, 24447333, 24685520, 24835790, 25351625, 25512523, 25747987, 25862761, 26062523, 26135006, 26165148, 26202364, 26503469, 26633383, 27352347, 27840963, 27983923, 27983930, 28053596, 28061797, 28256910, 28289332, 28401012, 28404949, 28565856, 28586029, 28623712, 28857346, 28903329, 28932123, 29029415, 29207060, 29213214, 29323740, 29393336, 29412697, 29434694, 29435436, 29568924, 29635391, 29805503, 29807230, 29845216, 29909077, 29936511, 30014744, 30092789, 30182951, 30249882, 30258193, 30280767, 30481748, 30506278, 30536897, 30657552, 30840262, 31000382, 31010399, 31011522, 31114985, 31116090, 31126199, 31340526, 31485669, 31516594, 31545400, 31601147, 31705676, 31807064, 31810390, 31850493		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37272097	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	31837294		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	18270270, 23408974, 25216292, 27840916		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	24336158, 25281027, 25756515, 28728166, 31319139, 31713081, 31737183		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37033258	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	28289071, 29437881, 29444704, 29725001, 29851197, 31009706, 31847241		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11531284, 16452192, 16545436, 17178867, 19029838, 21372221, 22094188, 22340595, 22585163, 23371322, 23591839, 23970345, 24011934, 24022196, 24115647, 24247248, 25677064, 25852062, 26159849, 26657155, 26909613, 26983899, 27082164, 28574782, 29113199, 29371953, 29401696, 29743815, 29909423, 29930760, 30129654, 30237504, 30245957, 30755818, 30925458, 30972187, 31128298, 31284467, 31638241		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	28025797		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12535639, 15851011, 17043657, 19405118, 20686216, 20807812, 21678117, 22170433, 22248802, 22509328, 22902833, 22952903, 23589145, 25152578, 25285629, 25376606, 26451606, 27176210, 27179037, 27220401, 27339327, 27426724, 27845911, 28000865, 28176634, 28320094, 28360038, 28442920, 28574828, 28583586, 29204055, 29348875, 29434912, 29753186, 29880482, 29898401, 29901184, 30046371, 30243721, 30323973, 30396902, 30464602, 30506130, 30536312, 30551529, 30555743, 30575903, 30738116, 31088502, 31128031, 31153980, 31531884, 31631174, 31649109, 31683659		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17483325, 20876794, 23453624, 24895459, 25452273, 25673820, 27179037, 27705906, 28176634, 28544376, 29040676, 29386088, 29526843, 29670543, 29898401, 30087712, 30261145		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21350002, 22116519, 22952903, 22975375, 28583586		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20581473, 32272917	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18000091, 20008098, 20186503, 20578891, 24220341, 25887589, 26133772, 28901486, 29387247, 29675113, 29885843, 30251060, 30387841, 30596336, 30811764, 31262968, 31289610		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10728713		★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	28352668		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16155123, 24528157, 24768803, 26806867, 28000847, 28005221, 28093210, 28181071, 28185818, 28190476, 28421199, 28461162, 28627590, 28902711, 29435803, 29515352, 29588573, 30184529, 30783448, 30925459, 30933849, 31295526, 31301558, 31331066, 31619646, 31811872		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	25311989, 29462900		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	27885243		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	28134235		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27283324		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28423567, 30471295		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28423567, 30471295		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25862915, 29245981		★☆☆☆☆ Found in Text Mining only
Perisylvian syndrome	Perisylvian Syndrome	BEFREE	31056854		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30061744		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	22692904, 27811202, 30217997		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	23895135, 30383904		★☆☆☆☆ Found in Text Mining only
PIK3CA related overgrowth spectrum	Overgrowth Spectrum	BEFREE	25915946, 26593112, 28867506, 29549527, 30197175, 31361678, 31693582		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	21113787, 28137267, 30499772		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	28445712		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	26562326		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	31836766		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30472374, 31715259		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	29615724		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27613818, 28990055, 29434814, 29660344, 31163591, 31185267		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19815050		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	25288776	Associate	★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	BEFREE	24888723, 28969385		★☆☆☆☆ Found in Text Mining only
Port-Wine Stain	Phakomatosis pigmentovascularis	BEFREE	28030367, 31067686		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	31067686		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	28390196		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	24244612, 28390196, 28777460, 29152059		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29152059		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	22685175, 24244612, 27018341, 29574283, 30669372		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	16019476, 18385752, 18765521, 18830414, 19406988, 19458356, 20007543, 21807868, 22885370, 23038273, 24952875, 25241901, 25869207, 27151993, 27582570, 28159681, 28716817, 29799846, 30701029, 30896824, 31096997, 31419997		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	29437881, 29444704, 29725001, 30032281, 31009706, 31847241		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	28012196, 29937999		★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	29563913, 31031754		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	23382981, 23445613		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	29726995		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	23258148, 30046527, 31467081, 31786159, 31850164		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12642685, 15788644, 16061480, 16328002, 16425184, 16651432, 17551921, 17826033, 18336616, 18615538, 18942118, 19099539, 19275762, 19443396, 19633975, 19787273, 20019190, 20197460, 20203370, 20530556, 20940396, 21138868, 21310825, 21575859, 22491797, 22509301, 23171135, 23434594, 23585456, 23623839, 23765843, 23798432, 24067903, 24163230, 24204196, 24294372, 24339862, 24652480, 24830689, 24831963, 24866151, 24972028, 24983969, 24991009, 25026288, 25120209, 25139413, 25275598, 25636507, 25640606, 25707690, 25799167, 25829425, 26124442, 26143945, 26261538, 26577921, 26986507, 27324222, 27357679, 27375016, 27426307, 27431052, 27470558, 27557496, 27588482, 27821815, 27966458, 27995550, 28061438, 28123608, 28212321, 28225015, 28314838, 28319045, 28350865, 28420128, 28422286, 28442344, 28631436, 28676490, 28915623, 28977864, 29133261, 29141866, 29181846, 29316844, 29328471, 29330287, 29453322, 29581176, 29730477, 29767248, 29792732, 29963230, 30012673, 30132513, 30133757, 30139961, 30142541, 30194716, 30208576, 30300679, 30320903, 30333093, 30379590, 30382885, 30483810, 30581390, 30733525, 30813597, 30854108, 30973040, 31016228, 31092266, 31228307, 31296553, 31345230, 31551414, 31726118, 31814446		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	29456672, 30900311		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	19395652		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15678501, 17551921		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16651432, 17551921, 19443396, 21062988, 23348742, 30133757		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23661456, 30179225, 31581661	Associate	★☆☆☆☆ Found in Text Mining only
Proteus Syndrome	Proteus Syndrome	BEFREE	30399177		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22840496, 23024273, 24168180, 27393705, 29432814, 29537306, 30483877, 31229693, 31401494		★☆☆☆☆ Found in Text Mining only
PTEN Hamartoma Tumor Syndrome	PTEN Hamartoma Tumor Syndrome	BEFREE	24366516, 27477328, 27860216, 31501268		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	30243568		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27087006, 29956736, 31841211		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21048214, 23439433, 24276150, 28263743, 28743499, 28900284, 29045477, 29079731, 30542075, 30602677, 31249375, 31502903		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20622004		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	28341395		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17362927, 19850877, 30288056, 30840265, 31007884		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16707436, 17468516, 18587247, 22950635, 23086777, 23219378, 23416459, 23900601, 24107265, 24448243, 24767687, 25757764, 25925728, 27387559, 27453294, 27844272, 27983909, 28049139, 28114284, 28350788, 29022645, 29148041, 29228703, 29389967, 29635281, 29667779, 29799306, 30327302, 30349421, 30431104, 30465826, 30607788, 30655739, 30774762, 31173226, 31259714, 31485634, 31545453		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18587247		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	26447680, 29759484, 30304547, 31032350		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	28193878, 28972999, 30632644		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	29523773		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31272134		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	26459773		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17604597, 19420344, 23071625, 23939377, 25070358, 25371235, 26948367, 28042956, 28445155, 28852437, 28901408, 28943916, 29098028, 29517104, 29615601, 29749457, 29790698, 30015924, 30320366, 31044388, 31483776, 31541850, 31727502		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32366932	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	26459773, 29862174		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	18641990, 29344246		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	10973962, 15342383, 23684925, 23918606, 24133218, 25637161, 25749378, 26209235, 29487419, 30319965, 31524277		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15642134, 19734303, 20228199, 22840496, 23001847, 23328930, 24470496, 25760103, 26723864, 26976956, 28090093, 28341395, 28559961, 29652658, 29710540, 30060822, 30229869, 30286793, 30378113, 30402834, 30503342, 30541899, 30639474, 30912120, 30954464, 30988781, 31028998, 31203157, 31739383, 31849678		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17290298		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	26824665		★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	29976496		★☆☆☆☆ Found in Text Mining only
Saethre-Chotzen Syndrome	Saethre-Chotzen Syndrome	BEFREE	17003487		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	27564547		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17496901, 20564403, 23300809, 24058690, 26479291, 27793898, 29401603		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	39519004	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22209534, 22689948, 22771711, 26960157, 27122041, 28384043, 31211828		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	15153536		★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	21078999		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	23996432, 27435399, 31771279		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	27104982, 30430771		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	29551659, 31266549		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20733008, 26839042, 27252170, 28458167, 29100348, 29956071, 30989579, 31007743, 31570770, 31806860		★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	BEFREE	18574502, 31384176		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	25133419		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	31682844		★☆☆☆☆ Found in Text Mining only
SHORT syndrome	SHORT Syndrome	BEFREE	23810382, 28143957, 28934384, 29724723		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	27297622		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	20557351		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25267489, 30506709		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31322006		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12356726, 15746061, 23172887, 24240111, 24482365, 25122428, 27101199, 27845189, 28280736, 28597653, 29290965, 29490947, 30429033		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	29179250		★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	BEFREE	30061744		★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	25150293, 25377560		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12097266, 18413757, 20045673, 20557351, 21110697, 22349826, 22629454, 23228846, 23607916, 24248467, 24500884, 25977343, 26030731, 26216950, 27845189, 27923688, 28693263, 28945300, 29616118, 29848679, 30519710, 30568499, 30867805, 30909080, 31213575, 31239711, 31251469, 31302247, 31319998, 31638186, 31737114, 31759362		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15543611		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22965424, 25099196, 25175594, 25839328, 25843419, 26191164, 26334393, 27130665, 27489353, 28384037, 28404945, 28418888, 28463955, 28548104, 28867195, 28903408, 29251330, 29463194, 29579711, 29581778, 29597090, 29738771, 29864623, 30050135, 30050313, 30119206, 30127937, 30368517, 30508543, 30594787, 30860495, 31001468, 31120582, 31173854, 31217847, 31308693, 31340168, 31463131, 31571914, 31582906		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26087196, 40650045	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24500884, 25813410, 26013318, 27835880, 27935865, 28652248, 29862232, 29891994, 30093452		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24641191, 25639555, 27793049, 28243326, 28623128, 28696382, 29238073, 30707166, 31747091		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11479233, 15543611, 17549376, 17848307, 17912526, 22020886, 22037217, 22065749, 23607916, 23619167, 23670291, 23873848, 24219320, 24425785, 24599075, 24696319, 24941990, 25099740, 25193510, 25424851, 25977343, 26589432, 26876212, 26895469, 27358485, 27507562, 28108737, 28119490, 28131786, 28194032, 28823407, 28945228, 29061642, 29232766, 29598951, 29970482, 30115483, 30770351, 30858165, 30926065, 31235758, 31393061, 31486207, 31574205, 31600013, 31678634		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	31312359, 31620898		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30041677, 31602231		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30116338, 31654704		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28357399, 28905319, 29724723, 30819264, 31790897		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	26909593		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15809724, 16627973, 19143835, 20937558, 20954287, 21841827, 22292935, 22334453, 22543857, 22799764, 22876838, 23058013, 23326131, 23661031, 23743572, 23813545, 23960014, 24068565, 24276243, 24458107, 24726064, 24837198, 25015565, 25085584, 25400827, 25613482, 25701378, 25727320, 25914465, 26201869, 26330014, 26543351, 26604635, 26701847, 27006499, 27121204, 27156070, 27470388, 27712585, 28260026, 28550907, 28588255, 28608528, 28671020, 28950928, 29069734, 29106389, 29208564, 29212166, 29215373, 29243780, 29257342, 29278851, 29282102, 29332342, 29374144, 29422964, 29422968, 29450946, 29522284, 29700210, 29767248, 29767389, 29802999, 29867504, 29872314, 29917165, 29949784, 30089248, 30134988, 30138931, 30176223, 30275715, 30302796, 30320337, 30344716, 30349304, 30389134, 30628706, 30632400, 30720166, 30793479, 30796154, 30816492, 30953349, 31207155, 31243897, 31297980, 31339445, 31352788, 31497207, 31527621, 31692102, 31713929, 31732769, 31737204, 31786865, 31816819, 31819646		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18824170		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37591783	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	29108713		★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	28030367, 30690033, 31067686		★☆☆☆☆ Found in Text Mining only
Sturge-Weber Syndrome	Sturge-Weber Syndrome	BEFREE	31067686		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26539501, 28986282, 29771435, 29885663, 30339347, 30935689, 31125530, 31203572, 31590996, 31706751		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	30300578		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	21128248		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	31829201		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	15153536, 30141531		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27658642, 29522278, 31359259, 31601188		★☆☆☆☆ Found in Text Mining only
Telangiectasia, Hereditary Hemorrhagic, Type 1	Telangiectasia	BEFREE	31450639		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	24277456, 29410498		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	19221038	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	27117832		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	23107319, 23236232, 23592320, 23613505, 24698130, 24888963, 26766736, 27068875, 27876891, 28192408, 28911139		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	24758182, 30193323, 31622470		★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	20001715, 28551845		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15928251, 17317825, 17545635, 17891251, 18502332, 19638576, 19706758, 19808899, 19907326, 20578891, 21289267, 21878896, 23128507, 24098937, 24781864, 26138515, 26265449, 26384552, 26456083, 26472282, 27258970, 27261581, 28042956, 28600475, 28838947, 29055016, 29163356, 29236327, 29272787, 29301825, 29353884, 29695638, 29969438, 30365150, 30699064, 30779728, 31285773, 31289610, 31727500		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	17426084		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15928251, 17317825, 17426084, 17545635, 17891251, 18502332, 19638576, 19706758, 19907326, 20186503, 20578891, 21289267, 21878896, 23128507, 24098937, 24136889, 24603332, 24781864, 26265449, 26456083, 26472282, 28042956, 28600475, 29055016, 29163356, 29236327, 29272787, 29301825, 29353884, 29969438, 30243708, 30365150, 30699064, 31285773, 31289610, 31727500		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18502332		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	30093941, 30906434		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	31484847		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	31484847		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	23107319		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22703543, 22915752, 23973711, 24236784, 24298072, 24420152, 24708766, 24779793, 25009009, 25103565, 25296970, 25501949, 25721419, 25857298, 26540293, 26676751, 26680641, 26857281, 26939876, 27196766, 27367565, 27374081, 27402769, 27563827, 27893038, 28003307, 28160548, 28486691, 28528184, 28576487, 28766167, 29069872, 29156674, 29203461, 29208466, 29228721, 29416611, 29417298, 29472518, 29617654, 29675095, 29891505, 29924958, 29988465, 30092563, 30139837, 30227836, 30266800, 30272286, 30289981, 30344670, 30363988, 30518934, 30564555, 30713576, 31050709, 31213851, 31217901, 31254268, 31464004, 31480338, 31520748, 31636720, 31680955, 31703728, 31717320, 31804921, 31812693, 31822498, 31841354		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30227836	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	12773158, 15653324, 16885382, 19177005, 19539245, 19545994, 21191642, 22544507, 25153728, 25277454, 27860216, 28777148		★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 1 (disorder)	Tuberous Sclerosis	BEFREE	29672222		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29731832, 31210320		★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19843858, 22110663, 22728270, 23107319, 28889394		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	15579294		★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	21903247		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	27748285, 29113583		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	22733540, 27881235, 30338785, 30770562, 31394192		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	BEFREE	28804726		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29512749		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30567315		★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	26637981, 27030595, 30855339		★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30487059		★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	28115595		★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	29534734, 31044535		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	31797544		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	28836394		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	28836394		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	18474617		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	25060991		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	30975663		★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	25133419		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	30628719		★☆☆☆☆ Found in Text Mining only