PIK3CD-AS1 (PIK3CD antisense RNA 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 644997
Gene name PIK3CD antisense RNA 1
Gene symbol PIK3CD-AS1
Synonyms (NCBI Gene)
C1orf200
Chromosome 1
Chromosome location 1p36.22
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SR53
Protein name Putative uncharacterized protein PIK3CD-AS1 (PIK3CD antisense RNA 1) (PIK3CD antisense gene protein 1)
Family and domains
Sequence 
MPSQSACPVLSTAPGTPCDLRKHLLNMVSEEKRSPQLSAKTWRRGLRLQKRRNALFLPEG
DICVVGSTSGARALIPETSKLERSGTVIAYCNLELLASSDPPVWASQSTGMTGMSYRSQP
QLGFKSTPPAHSSVFHHSVKAPKEDQAQEAASRPLTSQDGWNPNIKK
Sequence length 167
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Clear cell carcinoma of kidney Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Conventional (Clear Cell) Renal Cell Carcinoma Renal Carcinoma BEFREE 30337839
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 30337839
★★★★★
★☆☆☆☆
Found in Text Mining only
Renal Cell Carcinoma Renal Carcinoma BEFREE 30337839
★★★★★
★☆☆☆☆
Found in Text Mining only
Testicular Germ Cell Tumor Testicular Germ Cell Tumor GWASCAT_DG 28604728
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for PIK3CD-AS1.

No additional diseases found yet through genes similar to PIK3CD-AS1.