PIH1D1 (PIH1 domain containing 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55011
• Gene name: PIH1 domain containing 1
• Gene symbol: PIH1D1
• Synonyms (NCBI Gene): DNAAF14, MOT48, NOP17, Pih1
• Chromosome: 19
• Chromosome location: 19q13.33

miRNA Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032199	hsa-let-7b-5p	Proteomics	18668040
MIRT1233796	hsa-miR-4330	CLIP-seq
MIRT1233797	hsa-miR-515-5p	CLIP-seq
MIRT1233798	hsa-miR-942	CLIP-seq
MIRT1233796	hsa-miR-4330	CLIP-seq
MIRT2295878	hsa-miR-1305	CLIP-seq
MIRT2295879	hsa-miR-2909	CLIP-seq
MIRT2295880	hsa-miR-3162-5p	CLIP-seq
MIRT1233796	hsa-miR-4330	CLIP-seq
MIRT2295881	hsa-miR-4428	CLIP-seq
MIRT2295882	hsa-miR-4457	CLIP-seq
MIRT2295883	hsa-miR-4530	CLIP-seq
MIRT2295884	hsa-miR-4786-3p	CLIP-seq
MIRT1233797	hsa-miR-515-5p	CLIP-seq
MIRT2295885	hsa-miR-671-5p	CLIP-seq
MIRT1233798	hsa-miR-942	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000492	Process	Box C/D snoRNP assembly	IBA
GO:0000492	Process	Box C/D snoRNP assembly	IMP	17636026
GO:0001165	Function	RNA polymerase I cis-regulatory region sequence-specific DNA binding	IDA	22368283
GO:0005515	Function	Protein binding	IPI	16189514, 17636026, 20864032, 21078300, 24036451, 24656813, 25416956, 26496610, 26711270, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	22368283
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA	22368283
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	22368283
GO:0006338	Process	Chromatin remodeling	IMP	22368283
GO:0006364	Process	RRNA processing	IBA
GO:0019901	Function	Protein kinase binding	IPI	24036451
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0042393	Function	Histone binding	IPI	22368283
GO:0048254	Process	SnoRNA localization	IMP	17636026
GO:0050821	Process	Protein stabilization	NAS	29662061, 31738558
GO:0051117	Function	ATPase binding	IPI	17636026
GO:0051219	Function	Phosphoprotein binding	IPI	20864032
GO:0070761	Component	Pre-snoRNP complex	IDA	17636026
GO:0097255	Component	R2TP complex	IBA
GO:0097255	Component	R2TP complex	IDA	21078300, 26711270
GO:0097255	Component	R2TP complex	IPI	29662061
GO:0140566	Function	Histone reader activity	IMP	22368283
GO:1901838	Process	Positive regulation of transcription of nucleolar large rRNA by RNA polymerase I	IGI	22368283
GO:1901838	Process	Positive regulation of transcription of nucleolar large rRNA by RNA polymerase I	IMP	22368283, 24036451
GO:1902661	Process	Positive regulation of glucose mediated signaling pathway	IMP	22368283
GO:1903939	Process	Regulation of TORC2 signaling	IMP	24036451
GO:1904263	Process	Positive regulation of TORC1 signaling	IMP	24036451
GO:1905669	Process	TORC1 complex assembly	IDA	24036451
GO:1990062	Component	RPAP3/R2TP/prefoldin-like complex	IPI	31738558
GO:1990904	Component	Ribonucleoprotein complex	IBA

Other IDs

• MIM: 611480
• HGNC: 26075
• e!Ensembl: ENSG00000104872

Protein

• UniProt ID: Q9NWS0
• Protein name: PIH1 domain-containing protein 1 (Nucleolar protein 17 homolog)
• Protein function: Involved in the assembly of C/D box small nucleolar ribonucleoprotein (snoRNP) particles (PubMed:17636026). Recruits the SWI/SNF complex to the core promoter of rRNA genes and enhances pre-rRNA transcription (PubMed:22368283, PubMed:24036451). M
• PDB: 4PSF , 4PSI , 6GXZ , 7AVC , 8BDU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08190	PIH1	23 → 187	PIH1 N-terminal domain	Domain
  PF18201	PIH1_CS	211 → 286	PIH1 CS-like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low levels in normal mammary epithelial cells (at protein level) (PubMed:24036451). Highest expression in lung, leukocyte and placenta. Expressed at lower levels in brain, prostate, colon, heart, small intestine, liver, ov
• Sequence:

  MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNS
  SEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAY
  DVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIR
  SEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIG
  ENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS

• Sequence length: 290

Related Genes

No strongly related genes found yet for PIH1D1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PIH1D1.