PIGBOS1 (PIGB opposite strand 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 101928527
Gene name PIGB opposite strand 1
Gene symbol PIGBOS1
Synonyms (NCBI Gene)
HP06981
Chromosome 15
Chromosome location 15q21.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 31653868
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005741 Component Mitochondrial outer membrane IDA 31653868
GO:0005741 Component Mitochondrial outer membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618809 50696 ENSG00000225973
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A0B4J2F0
Protein name Protein PIGBOS1 (PIGB opposite strand protein 1)
Protein function Plays a role in regulation of the unfolded protein response triggered by endoplasmic reticulum (ER) stress resulting from the presence of unfolded proteins in the ER lumen.
Family and domains
Sequence 
MFRRLTFAQLLFATVLGIAGGVYIFQPVFEQYAKDQKELKEKMQLVQESEEKKS
Sequence length 54
Interactions View interactions

No strongly related genes found yet for PIGBOS1.

No additional diseases found yet through genes similar to PIGBOS1.