PIERCE2 (piercer of microtubule wall 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 145788
Gene name Piercer of microtubule wall 2
Gene symbol PIERCE2
Synonyms (NCBI Gene)
C14orf65C15orf65
Chromosome 15
Chromosome location 15q21.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21 Show/Hide all (21)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003341 Process Cilium movement IEA
GO:0003341 Process Cilium movement ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619669 44654 ENSG00000261652
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
H3BRN8
Protein name Piercer of microtubule wall 2 protein
Protein function Microtubule inner protein involved in the attachment of outer dynein arms (ODAs) to dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
PDB 7UNG , 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14892 DUF4490 4 → 109 Domain of unknown function (DUF4490) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269|PubMed:36191189}.
Sequence 
MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYK
TNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHT
L
Sequence length 121
Interactions View interactions

No strongly related genes found yet for PIERCE2.

No additional diseases found yet through genes similar to PIERCE2.