PIERCE1 (piercer of microtubule wall 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 138162
• Gene name: Piercer of microtubule wall 1
• Gene symbol: PIERCE1
• Synonyms (NCBI Gene): C9orf116, RbEST47
• Chromosome: 9
• Chromosome location: 9q34.3

miRNA Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT854007	hsa-miR-1265	CLIP-seq
MIRT854008	hsa-miR-155	CLIP-seq
MIRT854009	hsa-miR-3124-3p	CLIP-seq
MIRT854010	hsa-miR-3664-3p	CLIP-seq
MIRT854011	hsa-miR-4501	CLIP-seq
MIRT854012	hsa-miR-4504	CLIP-seq
MIRT854013	hsa-miR-4764-5p	CLIP-seq
MIRT854014	hsa-miR-518a-5p	CLIP-seq
MIRT854015	hsa-miR-527	CLIP-seq
MIRT854016	hsa-miR-542-3p	CLIP-seq
MIRT854017	hsa-miR-549	CLIP-seq
MIRT2191336	hsa-miR-1262	CLIP-seq
MIRT2191337	hsa-miR-1272	CLIP-seq
MIRT2191338	hsa-miR-3126-5p	CLIP-seq
MIRT2191339	hsa-miR-3682-3p	CLIP-seq
MIRT2191340	hsa-miR-4318	CLIP-seq
MIRT2191341	hsa-miR-4419a	CLIP-seq
MIRT2191342	hsa-miR-4510	CLIP-seq
MIRT2191343	hsa-miR-4701-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003341	Process	Cilium movement	IEA
GO:0003341	Process	Cilium movement	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IDA	36191189
GO:0005879	Component	Axonemal microtubule	IEA
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005929	Component	Cilium	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007368	Process	Determination of left/right symmetry	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0035082	Process	Axoneme assembly	IEA
GO:0035082	Process	Axoneme assembly	ISS
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0061966	Process	Establishment of left/right asymmetry	IEA
GO:0061966	Process	Establishment of left/right asymmetry	ISS
GO:0071494	Process	Cellular response to UV-C	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	ISS

Other IDs

• MIM: 614502
• HGNC: 28435
• e!Ensembl: ENSG00000160345

Protein

• UniProt ID: Q5BN46
• Protein name: Piercer of microtubule wall 1 protein (Pierce1) (UPF0691 protein C9orf116) (p53-induced expression in RB-null cells protein 1)
• Protein function: Microtubule inner protein involved in the attachment of outer dynein arms (ODAs) to dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating (PubMed:36191189). Functions at the initial step of lef
• PDB: 7UNG , 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14892	DUF4490	4 → 106	Domain of unknown function (DUF4490)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269|PubMed:36191189}.
• Sequence:

  MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN
  QAYGSRAPTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDR
  LNFHPSYNINRPSICD

• Sequence length: 136

Related Genes

No strongly related genes found yet for PIERCE1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PIERCE1.