Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	221476
Gene name	Peptidase inhibitor 16
Gene symbol	PI16
Synonyms (NCBI Gene)	CD364CRISP9MSMBBPPSPBP
Chromosome	6
Chromosome location	6p21.2

8 Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023574	hsa-miR-1-3p	Microarray	18668037
MIRT1232688	hsa-miR-1193	CLIP-seq
MIRT1232689	hsa-miR-1827	CLIP-seq
MIRT1232690	hsa-miR-3064-3p	CLIP-seq
MIRT1232691	hsa-miR-3650	CLIP-seq
MIRT1232692	hsa-miR-4520a-3p	CLIP-seq
MIRT1232693	hsa-miR-4520b-3p	CLIP-seq
MIRT1232694	hsa-miR-4715-3p	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6UXB8

Protein name

Peptidase inhibitor 16 (PI-16) (Cysteine-rich secretory protein 9) (CRISP-9) (PSP94-binding protein) (CD antigen CD364)

Protein function

May inhibit cardiomyocyte growth.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00188	CAP	37 → 165	Cysteine-rich secretory protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in prostate, testis, ovary and intestine. Concentrates in prostate cancer patient's sera. {ECO:0000269|PubMed:15344909, ECO:0000269|PubMed:17062675}.

Sequence

MHGSCSFLMLLLPLLLLLVATTGPVGALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWD
EELAAFAKAYARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATC
SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEG
TPCSQCPSGYHCKNSLCEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGI
PAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVTTEVPSILAAHSLPSL
DEEPVTFPKSTHVPIPKSADKVTDKTKVPSRSPENSLDPKMSLTGARELLPHAQEEAEAE
AELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGGRALALQS
SLPGAEGPDKPSVVSGLNSGPGHVWGPLLGLLLLPPLVLAGIF

Sequence length

463

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	34099189	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	30177863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34099189	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	34099189	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Dementia	Dementia	Pubtator	34341761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	31127857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31127857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	35502856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15344909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15344909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17062675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19644707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39524442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37525118	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	36178657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with PI16 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PI16.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PI16 (see Related Genes above), that are NOT already directly curated for PI16 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PI16.

PI16 (peptidase inhibitor 16)

Bookmark This Gene