PHYHD1 (phytanoyl-CoA dioxygenase domain containing 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 254295
Gene name Phytanoyl-CoA dioxygenase domain containing 1
Gene symbol PHYHD1
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q34.11
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1232576 hsa-miR-3129-3p CLIP-seq
MIRT1232577 hsa-miR-3591-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21044950
GO:0016491 Function Oxidoreductase activity IEA
GO:0016706 Function 2-oxoglutarate-dependent dioxygenase activity IDA 21530488
GO:0046872 Function Metal ion binding IEA
GO:0051213 Function Dioxygenase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620042 23396 ENSG00000175287
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SRE7
Protein name Phytanoyl-CoA dioxygenase domain-containing protein 1 (Protein PHYHD1) (EC 1.14.11.-)
Protein function 2-oxoglutarate(2OG)-dependent dioxygenase that catalyzes the conversion of 2-oxoglutarate to succinate and CO(2) in an iron-dependent manner (PubMed:21530488). However, does not couple 2OG turnover to the hydroxylation of acyl-coenzyme A derivat
PDB 2OPW , 3OBZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05721 PhyH 12 → 259 Phytanoyl-CoA dioxygenase (PhyH) Domain
Sequence 
MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQ
LRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHS
FKVQTLARSLGLQMPVVVQSMYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDA
TLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLI
HGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQLYT
Sequence length 291
Interactions View interactions

No strongly related genes found yet for PHYHD1.

No additional diseases found yet through genes similar to PHYHD1.