Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51131
Gene name	PHD finger protein 11
Gene symbol	PHF11
Synonyms (NCBI Gene)	APYBCAPIGELIGERIGHERNY-REN-34NYREN34
Chromosome	13
Chromosome location	13q14.2
Summary	This gene encodes a protein containing a PHD (plant homeodomain) type zinc finger. This gene has been identified in some studies as a candidate gene for asthma. Naturally-occurring readthrough transcription may occur from the upstream SETDB2 (SET domain b

37 Show/Hide all (37)

miRTarBase ID	miRNA	Experiments
MIRT1229930	hsa-miR-1290	CLIP-seq
MIRT1229931	hsa-miR-147	CLIP-seq
MIRT1229932	hsa-miR-1587	CLIP-seq
MIRT1229933	hsa-miR-2681	CLIP-seq
MIRT1229934	hsa-miR-27a	CLIP-seq
MIRT1229935	hsa-miR-27b	CLIP-seq
MIRT1229936	hsa-miR-3150b-3p	CLIP-seq
MIRT1229937	hsa-miR-3167	CLIP-seq
MIRT1229938	hsa-miR-3168	CLIP-seq
MIRT1229939	hsa-miR-326	CLIP-seq
MIRT1229940	hsa-miR-330-5p	CLIP-seq
MIRT1229941	hsa-miR-3663-5p	CLIP-seq
MIRT1229942	hsa-miR-3691-5p	CLIP-seq
MIRT1229943	hsa-miR-3911	CLIP-seq
MIRT1229944	hsa-miR-3975	CLIP-seq
MIRT1229945	hsa-miR-4492	CLIP-seq
MIRT1229946	hsa-miR-4498	CLIP-seq
MIRT1229947	hsa-miR-4509	CLIP-seq
MIRT1229948	hsa-miR-4649-3p	CLIP-seq
MIRT1229949	hsa-miR-4656	CLIP-seq
MIRT1229950	hsa-miR-4675	CLIP-seq
MIRT1229951	hsa-miR-4741	CLIP-seq
MIRT1229952	hsa-miR-4744	CLIP-seq
MIRT1229953	hsa-miR-4752	CLIP-seq
MIRT1229954	hsa-miR-4784	CLIP-seq
MIRT1229955	hsa-miR-4795-3p	CLIP-seq
MIRT1229956	hsa-miR-4799-5p	CLIP-seq
MIRT1229957	hsa-miR-513a-5p	CLIP-seq
MIRT1229958	hsa-miR-576-3p	CLIP-seq
MIRT1229959	hsa-miR-593	CLIP-seq
MIRT1229960	hsa-miR-644	CLIP-seq
MIRT1229961	hsa-miR-762	CLIP-seq
MIRT1229962	hsa-miR-876-5p	CLIP-seq
MIRT2294931	hsa-miR-4511	CLIP-seq
MIRT2294932	hsa-miR-4773	CLIP-seq
MIRT2294933	hsa-miR-505	CLIP-seq
MIRT2294934	hsa-miR-548b-3p	CLIP-seq

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
607796	17024	ENSG00000136147

Q9UIL8

Protein name

PHD finger protein 11 (BRCA1 C-terminus-associated protein) (Renal carcinoma antigen NY-REN-34)

Protein function

Positive regulator of Th1-type cytokine gene expression.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13771	zf-HC5HC2H	68 → 160		Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small in

Sequence

MAQASPPRPERVLGASSPEARPAQEALLLPTGVFQVAEKMEKRTCALCPKDVEYNVLYFA
QSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATV
GCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGR
KKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDK
VHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEI
ELLQDLKQTLCSFQENRDLMSSSTSISSLSY

Sequence length

331

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PHF11-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (17)
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21625490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12754510, 17702965, 19672052, 19951440, 21320718, 26378653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	12754510, 17702965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17702965, 18405956, 19386584, 19951440, 21320718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	24005033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	19951440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	30278285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	26573531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	18405956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	18405956, 20421878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	24005033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis	Keratoconjunctivitis	BEFREE	26706344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29796116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24005033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	27884671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	24005033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	30278285		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with PHF11 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PHF11.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PHF11 (see Related Genes above), that are NOT already directly curated for PHF11 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PHF11.

PHF11 (PHD finger protein 11)

Bookmark This Gene