Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55274
Gene name	PHD finger protein 10
Gene symbol	PHF10
Synonyms (NCBI Gene)	BAF45ASMARCG4XAP135
Chromosome	6
Chromosome location	6q27
Summary	This gene contains a predicted ORF that encodes a protein with two zinc finger domains. The function of the encoded protein is not known. Sequence analysis suggests that multiple alternatively spliced transcript variants are derived from this gene but the

12 Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006452	hsa-miR-409-3p	Luciferase reporter assayqRT-PCRWestern blot	22388101
MIRT006452	hsa-miR-409-3p	Luciferase reporter assayqRT-PCRWestern blot	22388101
MIRT006452	hsa-miR-409-3p	Luciferase reporter assayqRT-PCRWestern blot	22388101
MIRT006452	hsa-miR-409-3p	Luciferase reporter assayqRT-PCRWestern blot	22388101
MIRT024283	hsa-miR-215-5p	Microarray	19074876
MIRT024283	hsa-miR-215-5p	Microarray	19074876
MIRT026603	hsa-miR-192-5p	Microarray	19074876
MIRT028140	hsa-miR-93-5p	Sequencing	20371350
MIRT047753	hsa-miR-7-5p	CLASH	23622248
MIRT046346	hsa-miR-23b-3p	CLASH	23622248
MIRT038572	hsa-miR-106b-3p	CLASH	23622248
MIRT006452	hsa-miR-409-3p	Luciferase reporter assayWestern blottingqRT-PCR	32547084

31 Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000776	Component	Kinetochore	NAS	11078522
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	NAS	12192000
GO:0003682	Function	Chromatin binding	IBA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0004402	Function	Histone acetyltransferase activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006338	Process	Chromatin remodeling	NAS	10078207
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	17340523, 18809673
GO:0007399	Process	Nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016363	Component	Nuclear matrix	NAS	9128241
GO:0016514	Component	SWI/SNF complex	NAS	8804307
GO:0016586	Component	RSC-type complex	NAS	8804307
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	NAS	23698369, 25066234
GO:0045582	Process	Positive regulation of T cell differentiation	NAS	12110891
GO:0045597	Process	Positive regulation of cell differentiation	NAS	11790558
GO:0045663	Process	Positive regulation of myoblast differentiation	NAS	15985610
GO:0046872	Function	Metal ion binding	IEA
GO:0070316	Process	Regulation of G0 to G1 transition	NAS	11790558
GO:0071564	Component	NpBAF complex	IEA
GO:0071564	Component	NpBAF complex	ISS
GO:0071564	Component	NpBAF complex	NAS	8804307
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	19279220
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	NAS	10778858
GO:2000781	Process	Positive regulation of double-strand break repair	NAS	16932743, 25066234
GO:2000819	Process	Regulation of nucleotide-excision repair	NAS	12215535

MIM	HGNC	e!Ensembl
613069	18250	ENSG00000130024

Q8WUB8

Protein name

PHD finger protein 10 (BRG1-associated factor 45a) (BAF45a) (XAP135)

Protein function

Involved in transcription activity regulation by chromatin remodeling. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development

PDB

7VDV , 7Y8R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00628	PHD	435 → 481	PHD-finger	Domain
PF00628	PHD	379 → 436	PHD-finger	Domain

Sequence

MAAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETS
SQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEK
LYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEY
SQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKY
KVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGD
SDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKR
SVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELV
SMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQR
APPTPRKVGRRGKNSKEG

Sequence length

498

Interactions

View interactions

KEGG Pathway
ATP-dependent chromatin remodeling
Hepatocellular carcinoma

PHF10 (PHD finger protein 10)

Bookmark This Gene