PHETA2 (PH domain containing endocytic trafficking adaptor 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 150368
• Gene name: PH domain containing endocytic trafficking adaptor 2
• Gene symbol: PHETA2
• Synonyms (NCBI Gene): FAM109B, IPIP27B, Ses2
• Chromosome: 22
• Chromosome location: 22q13.2

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001881	Process	Receptor recycling	IBA
GO:0001881	Process	Receptor recycling	IMP	21233288
GO:0005515	Function	Protein binding	IPI	21233288, 27107012, 28514442, 32296183, 33961781
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	21233288
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IDA	21233288
GO:0005829	Component	Cytosol	IEA
GO:0007032	Process	Endosome organization	IBA
GO:0007032	Process	Endosome organization	IMP	21233288
GO:0030136	Component	Clathrin-coated vesicle	IDA	21233288
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IBA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IMP	21233288
GO:0042803	Function	Protein homodimerization activity	IPI	21233288
GO:0055037	Component	Recycling endosome	IBA
GO:0055037	Component	Recycling endosome	IDA	21233288
GO:0055037	Component	Recycling endosome	IEA

Other IDs

• MIM: 614240
• HGNC: 27161
• e!Ensembl: ENSG00000177096

Protein

• UniProt ID: Q6ICB4
• Protein name: Sesquipedalian-2 (Ses2) (27 kDa inositol polyphosphate phosphatase interacting protein B) (IPIP27B) (PH domain-containing endocytic trafficking adaptor 2)
• Protein function: Plays a role in endocytic trafficking. Required for receptor recycling from endosomes, both to the trans-Golgi network and the plasma membrane.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	18 → 121	PH domain	Domain

• Sequence:

  MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREG
  RAPLSLVVLEGCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRAS
  FGYMRLVVRELESQLQDARQSLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSS
  PVGLVEEAGSRSAGWGLAEWELQGPASLLLGKGQSPVSPETSCFSTLHDWYGQEIVELRQ
  CWQKRAQGSHSKCEEQDRP

• Sequence length: 259

Related Genes

No strongly related genes found yet for PHETA2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PHETA2.