PGLYRP2 (peptidoglycan recognition protein 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 114770
• Gene name: Peptidoglycan recognition protein 2
• Gene symbol: PGLYRP2
• Synonyms (NCBI Gene): HMFT0141, PGLYRPL, PGRP-L, PGRPL, TAGL-like, tagL, tagL-alpha, tagl-beta
• Chromosome: 19
• Chromosome location: 19p13.12
• Summary: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	16714290
SP1	Unknown	16714290

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001519	Process	Peptide amidation	NAS	7663175
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006955	Process	Immune response	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008745	Function	N-acetylmuramoyl-L-alanine amidase activity	IDA	14506276
GO:0008745	Function	N-acetylmuramoyl-L-alanine amidase activity	IEA
GO:0008745	Function	N-acetylmuramoyl-L-alanine amidase activity	TAS	7663175
GO:0009253	Process	Peptidoglycan catabolic process	IEA
GO:0016019	Function	Peptidoglycan immune receptor activity	IDA	11461926
GO:0016019	Function	Peptidoglycan immune receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11461926
GO:0016045	Process	Detection of bacterium	IDA	11461926
GO:0016045	Process	Detection of bacterium	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032827	Process	Negative regulation of natural killer cell differentiation involved in immune response	IEA
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042834	Function	Peptidoglycan binding	IDA	11461926
GO:0042834	Function	Peptidoglycan binding	IEA
GO:0045087	Process	Innate immune response	NAS	11461926
GO:0046872	Function	Metal ion binding	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	11461926
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051701	Process	Biological process involved in interaction with host	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 608199
• HGNC: 30013
• e!Ensembl: ENSG00000161031

Protein

• UniProt ID: Q96PD5
• Protein name: N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) (Peptidoglycan recognition protein 2) (Peptidoglycan recognition protein long) (PGRP-L)
• Protein function: May play a scavenger role by digesting biologically active peptidoglycan (PGN) into biologically inactive fragments. Has no direct bacteriolytic activity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01510	Amidase_2	401 → 533	N-acetylmuramoyl-L-alanine amidase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in liver and fetal liver, and secreted into serum. Expressed to a much lesser extent in transverse colon, lymph nodes, heart, thymus, pancreas, descending colon, stomach and testis. Isoform 2 is not detected in the l
• Sequence:

  MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNS
  GPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVA
  VEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDV
  TTADIGANTPDATKGCPDVQASLPDAKAKSPPTMVDSLLAVTLAGNLGLTFLRGSQTQSH
  PDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGVILGDYLSRTPEPRPSLSHLL
  SQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQ
  LAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCT
  DFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGV
  AIVGNYTAALPTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLR
  TWPHFTATVKPRPARSVSKRSRREPPPRTLPATDLQ

• Sequence length: 576

Pathways

Reactome Pathway:

Antimicrobial peptides

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (12)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autistic Disorder	Autism	BEFREE	27843150		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31479523	Inhibit	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	24533043	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18649358	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23812039		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31479523		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34461924	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	34461924	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31479523		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24838182		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24838182	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23812039		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PGLYRP2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PGLYRP2.