PGC (progastricsin)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5225
• Gene name: Progastricsin
• Gene symbol: PGC
• Synonyms (NCBI Gene): PEPC, PGII
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the ser

miRNA Show/Hide all (35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT733482	hsa-let-7c-3p	Luciferase reporter assay, qRT-PCR	34093839
MIRT2294124	hsa-miR-3929	CLIP-seq
MIRT2294125	hsa-miR-4419b	CLIP-seq
MIRT2294126	hsa-miR-4478	CLIP-seq
MIRT2294127	hsa-miR-520a-5p	CLIP-seq
MIRT2294128	hsa-miR-525-5p	CLIP-seq
MIRT2294129	hsa-miR-759	CLIP-seq
MIRT2456288	hsa-miR-3125	CLIP-seq
MIRT2456289	hsa-miR-335	CLIP-seq
MIRT2456290	hsa-miR-3916	CLIP-seq
MIRT2456291	hsa-miR-939	CLIP-seq
MIRT2592090	hsa-miR-3144-5p	CLIP-seq
MIRT2592091	hsa-miR-3191	CLIP-seq
MIRT2592092	hsa-miR-3199	CLIP-seq
MIRT2592093	hsa-miR-4260	CLIP-seq
MIRT2592094	hsa-miR-4283	CLIP-seq
MIRT2592095	hsa-miR-4292	CLIP-seq
MIRT2592096	hsa-miR-4308	CLIP-seq
MIRT2592097	hsa-miR-4489	CLIP-seq
MIRT2592098	hsa-miR-4515	CLIP-seq
MIRT2592099	hsa-miR-4652-5p	CLIP-seq
MIRT2592100	hsa-miR-4667-5p	CLIP-seq
MIRT2592101	hsa-miR-4700-5p	CLIP-seq
MIRT2592090	hsa-miR-3144-5p	CLIP-seq
MIRT2592091	hsa-miR-3191	CLIP-seq
MIRT2592092	hsa-miR-3199	CLIP-seq
MIRT2592093	hsa-miR-4260	CLIP-seq
MIRT2592094	hsa-miR-4283	CLIP-seq
MIRT2592095	hsa-miR-4292	CLIP-seq
MIRT2592096	hsa-miR-4308	CLIP-seq
MIRT2592097	hsa-miR-4489	CLIP-seq
MIRT2592098	hsa-miR-4515	CLIP-seq
MIRT2592099	hsa-miR-4652-5p	CLIP-seq
MIRT2592100	hsa-miR-4667-5p	CLIP-seq
MIRT2592101	hsa-miR-4700-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002803	Process	Positive regulation of antibacterial peptide production	IMP	12759353
GO:0004190	Function	Aspartic-type endopeptidase activity	IBA
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0004190	Function	Aspartic-type endopeptidase activity	IMP	12759353
GO:0004190	Function	Aspartic-type endopeptidase activity	TAS	3335549
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12759353
GO:0005615	Component	Extracellular space	TAS	3335549
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	3335549
GO:0007586	Process	Digestion	IEA
GO:0007586	Process	Digestion	TAS	3335549
GO:0008233	Function	Peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: 169740
• HGNC: 8890
• e!Ensembl: ENSG00000096088

Protein

• UniProt ID: P20142
• Protein name: Gastricsin (EC 3.4.23.3) (Pepsinogen C)
• Protein function: Hydrolyzes a variety of proteins.
• PDB: 1AVF , 1HTR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00026	Asp	72 → 387	Eukaryotic aspartyl protease	Family
  PF07966	A1_Propeptide	18 → 46	A1 Propeptide	Motif

• Sequence:

  MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLS
  VTYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSES
  STYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIM
  GLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQIY
  WAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQE
  DEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPTYLSSQNGQPL
  WILGDVFLRSYYSVYDLGNNRVGFATAA

• Sequence length: 388

Related Genes

No strongly related genes found yet for PGC.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PGC.