PGA4 (pepsinogen A4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 643847
Gene name Pepsinogen A4
Gene symbol PGA4
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11q12.2
Summary This gene encodes a protein precursor of the digestive enzyme pepsin, a member of the peptidase A1 family of endopeptidases. The encoded precursor is secreted by gastric chief cells and undergoes autocatalytic cleavage in acidic conditions to form the act
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1226606 hsa-miR-4436a CLIP-seq
MIRT1226607 hsa-miR-4700-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004190 Function Aspartic-type endopeptidase activity IBA
GO:0004190 Function Aspartic-type endopeptidase activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0006508 Process Proteolysis IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
169720 8886 ENSG00000229183
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DJD7
Protein name Pepsin A-4 (EC 3.4.23.1) (Pepsinogen-4)
Protein function Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.
PDB 1FLH , 1PSN , 1PSO , 1QRP , 3UTL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00026 Asp 75 → 387 Eukaryotic aspartyl protease Family
PF07966 A1_Propeptide 17 → 45 A1 Propeptide Motif
Sequence 
MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAP
TLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNP
EDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFD
GILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGS
LNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGAS
ENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGEL
WILGDVFIRQYFTVFDRANNQVGLAPVA
Sequence length 388
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Protein digestion and absorption Surfactant metabolism
Sort by:
PGA5 2 shared pathwaysProtein digestion and absorption, Surfactant metabolism Related via 2 shared pathways including Protein digestion and absorption, Surfactant metabolism. PGA3 2 shared pathwaysProtein digestion and absorption, Surfactant metabolism Related via 2 shared pathways including Protein digestion and absorption, Surfactant metabolism.
Esotropia Linked via 1 of 2 related genesPGA5 Breast neoplasms Linked via 1 of 2 related genesPGA3