PFDN6 (prefoldin subunit 6)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 10471
• Gene name: Prefoldin subunit 6
• Gene symbol: PFDN6
• Synonyms (NCBI Gene): H2-KE2, HKE2, KE-2, PFD6
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: PFDN6 is a subunit of the heteromeric prefoldin complex that chaperones nascent actin (see MIM 102560) and alpha- and beta-tubulin (see MIM 602529 and MIM 191130, respectively) chains pending their transfer to the cytosolic chaperonin containing TCP1 (MIM

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049091	hsa-miR-92a-3p	CLASH	23622248
MIRT044826	hsa-miR-320a	CLASH	23622248
MIRT044258	hsa-miR-106b-5p	CLASH	23622248
MIRT040317	hsa-miR-615-3p	CLASH	23622248
MIRT040317	hsa-miR-615-3p	CLASH	23622248
MIRT1226151	hsa-miR-101	CLIP-seq
MIRT1226152	hsa-miR-139-5p	CLIP-seq
MIRT1226153	hsa-miR-144	CLIP-seq
MIRT1226154	hsa-miR-1470	CLIP-seq
MIRT1226155	hsa-miR-22	CLIP-seq
MIRT1226156	hsa-miR-3938	CLIP-seq
MIRT1226157	hsa-miR-4667-3p	CLIP-seq
MIRT1226158	hsa-miR-548v	CLIP-seq
MIRT1226159	hsa-miR-558	CLIP-seq
MIRT1226160	hsa-miR-642a	CLIP-seq
MIRT1226151	hsa-miR-101	CLIP-seq
MIRT1226152	hsa-miR-139-5p	CLIP-seq
MIRT1226153	hsa-miR-144	CLIP-seq
MIRT1226155	hsa-miR-22	CLIP-seq
MIRT1226161	hsa-miR-3934	CLIP-seq
MIRT1226158	hsa-miR-548v	CLIP-seq
MIRT1226159	hsa-miR-558	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IDA	23614719
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	NAS	9630229, 32699605
GO:0016272	Component	Prefoldin complex	IBA
GO:0016272	Component	Prefoldin complex	IDA	9630229, 23614719, 30955883
GO:0016272	Component	Prefoldin complex	IEA
GO:0016272	Component	Prefoldin complex	NAS	32699605
GO:0032991	Component	Protein-containing complex	IEA
GO:0050821	Process	Protein stabilization	NAS	29662061, 31738558
GO:0051082	Function	Unfolded protein binding	IDA	30955883
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	NAS	9630229
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051087	Function	Protein-folding chaperone binding	IDA	9630229
GO:0051131	Process	Chaperone-mediated protein complex assembly	IBA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	9630229
GO:0101031	Component	Protein folding chaperone complex	NAS	29662061
GO:1905907	Process	Negative regulation of amyloid fibril formation	IDA	23614719
GO:1990062	Component	RPAP3/R2TP/prefoldin-like complex	IPI	31738558

Other IDs

• MIM: 605660
• HGNC: 4926
• e!Ensembl: ENSG00000204220

Protein

• UniProt ID: O15212
• Protein name: Prefoldin subunit 6 (Protein Ke2)
• Protein function: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. {ECO:0000269|Pub
• PDB: 6NR8 , 6NR9 , 6NRB , 6NRC , 6NRD , 7WU7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01920	Prefoldin_2	10 → 115	Prefoldin subunit	Coiled-coil

• Sequence:

  MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
  GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQA
  AKAGAPGKA

• Sequence length: 129

Related Genes

No strongly related genes found yet for PFDN6.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PFDN6.