PFDN2 (prefoldin subunit 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5202
• Gene name: Prefoldin subunit 2
• Gene symbol: PFDN2
• Synonyms (NCBI Gene): PFD2
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The

miRNA Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016457	hsa-miR-193b-3p	Proteomics	21512034
MIRT049268	hsa-miR-92a-3p	CLASH	23622248
MIRT047002	hsa-miR-210-3p	CLASH	23622248
MIRT039815	hsa-miR-615-3p	CLASH	23622248
MIRT038880	hsa-miR-93-3p	CLASH	23622248
MIRT550837	hsa-miR-5692a	PAR-CLIP	20371350
MIRT563598	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT563597	hsa-miR-5688	PAR-CLIP	20371350
MIRT563596	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT563595	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT550836	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT550835	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT563594	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT550834	hsa-miR-3919	PAR-CLIP	20371350
MIRT550837	hsa-miR-5692a	PAR-CLIP	21572407
MIRT550836	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT550835	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT550834	hsa-miR-3919	PAR-CLIP	21572407
MIRT550837	hsa-miR-5692a	PAR-CLIP	20371350
MIRT563598	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT563597	hsa-miR-5688	PAR-CLIP	20371350
MIRT563596	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT563595	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT550836	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT550835	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT563594	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT550834	hsa-miR-3919	PAR-CLIP	20371350
MIRT550837	hsa-miR-5692a	PAR-CLIP	21572407
MIRT550836	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT550835	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT550834	hsa-miR-3919	PAR-CLIP	21572407
MIRT1226118	hsa-miR-3132	CLIP-seq
MIRT1226119	hsa-miR-4650-3p	CLIP-seq
MIRT1226118	hsa-miR-3132	CLIP-seq
MIRT1226119	hsa-miR-4650-3p	CLIP-seq
MIRT2293753	hsa-miR-4795-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IDA	23614719
GO:0005515	Function	Protein binding	IPI	15923622, 16876117, 17936702, 25036637, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	16876117, 17936702
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16876117, 17936702
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	17936702
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	NAS	9630229, 32699605
GO:0016272	Component	Prefoldin complex	IDA	23614719, 30955883
GO:0016272	Component	Prefoldin complex	IEA
GO:0016272	Component	Prefoldin complex	NAS	9630229, 32699605
GO:0032991	Component	Protein-containing complex	IEA
GO:0044183	Function	Protein folding chaperone	IBA
GO:0044183	Function	Protein folding chaperone	IPI	16876117
GO:0050821	Process	Protein stabilization	NAS	29662061, 31738558
GO:0051082	Function	Unfolded protein binding	IDA	30955883
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	NAS	9630229
GO:0051495	Process	Positive regulation of cytoskeleton organization	IDA	16876117
GO:0101031	Component	Protein folding chaperone complex	NAS	29662061
GO:1905907	Process	Negative regulation of amyloid fibril formation	IDA	23614719
GO:1990062	Component	RPAP3/R2TP/prefoldin-like complex	IPI	31738558

Other IDs

• MIM: 613466
• HGNC: 8867
• e!Ensembl: ENSG00000143256

Protein

• UniProt ID: Q9UHV9
• Protein name: Prefoldin subunit 2
• Protein function: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. {ECO:0000269|Pub
• PDB: 6NR8 , 6NR9 , 6NRB , 6NRC , 6NRD , 7WU7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01920	Prefoldin_2	24 → 129	Prefoldin subunit	Coiled-coil

• Sequence:

  MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDT
  LKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFRE
  KHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

• Sequence length: 154

Related Genes

No strongly related genes found yet for PFDN2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PFDN2.