PEAK3 (PEAK family member 3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 374872
Gene name PEAK family member 3
Gene symbol PEAK3
Synonyms (NCBI Gene)
C19orf35
Chromosome 19
Chromosome location 19p13.3
miRNA miRNA information provided by mirtarbase database.
19 Show/Hide all (19)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT631652 hsa-miR-1183 HITS-CLIP 23824327
MIRT631651 hsa-miR-6499-5p HITS-CLIP 23824327
MIRT631650 hsa-miR-3137 HITS-CLIP 23824327
MIRT631649 hsa-miR-4284 HITS-CLIP 23824327
MIRT631648 hsa-miR-24-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004672 Function Protein kinase activity IBA
GO:0005515 Function Protein binding IPI 31311869
GO:0005925 Component Focal adhesion IBA
GO:0008360 Process Regulation of cell shape IMP 31311869
GO:0015629 Component Actin cytoskeleton IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618526 24793 ENSG00000188305
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZS72
Protein name Protein PEAK3
Protein function Probable catalytically inactive kinase (Probable). Interacts with CRK-II and antagonizes CRK-II-signaling. Prevents the formation of CRK-II-dependent membrane ruffling and lamellipodia-like extensions (PubMed:31311869). {ECO:0000269|PubMed:31311
PDB 8DGO , 8DGP , 8DP5 , 8DS6
Family and domains
Sequence 
MSSPEPPTEPPEPDNPTWSTQPTYSNLGQIRAHLLPSKACRLRTPGSLSTNPEPLPPPLP
KKILTRTQSLPTRRTLHPSSIQVQPPRRPFLGSHSVDKSQAAVGPACLPAELTFGPADAP
LGLSLRDLHSPEAVHTALAARQLQGLRTIYARLRARLMGGHPGPCHPGHSFRLLDSSPCA
ESGDALYYRVVRAHEDAWHILVAKVPKPGADVPHPWGLELQASLSPHFNLQGLCGLVPEG
TLPGAPWRGAVALAAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQLSAALKFLEAWGA
ALVELRPENLLLVAPRGCATTGPPRLLLTDFGRVCLQPPGPPGSPGPHAPQLGSLLRALL
SLAAPSTTPLAAGLELLAAQLTRLRPSASRTRGALQALLWGPGPELRGRGAPLGPWLRAL
GPWLRVRRGLLVLRLAERAAGGEAPSLEDWLCCEYLAEATESSMGQALALLWD
Sequence length 473
Interactions View interactions

No strongly related genes found yet for PEAK3.

No additional diseases found yet through genes similar to PEAK3.