PDZRN4 (PDZ domain containing ring finger 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 29951
• Gene name: PDZ domain containing ring finger 4
• Gene symbol: PDZRN4
• Synonyms (NCBI Gene): LNX4, SAMCAP3L
• Chromosome: 12
• Chromosome location: 12q12

miRNA Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021946	hsa-miR-128-3p	Microarray	17612493
MIRT545120	hsa-miR-4282	PAR-CLIP	21572407
MIRT545119	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT545118	hsa-miR-4311	PAR-CLIP	21572407
MIRT545117	hsa-miR-1276	PAR-CLIP	21572407
MIRT545116	hsa-miR-583	PAR-CLIP	21572407
MIRT545115	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT545114	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT545113	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT545112	hsa-miR-4719	PAR-CLIP	21572407
MIRT545111	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT545110	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT545109	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT545120	hsa-miR-4282	PAR-CLIP	21572407
MIRT545119	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT545118	hsa-miR-4311	PAR-CLIP	21572407
MIRT545117	hsa-miR-1276	PAR-CLIP	21572407
MIRT545116	hsa-miR-583	PAR-CLIP	21572407
MIRT545115	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT545114	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT545113	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT545112	hsa-miR-4719	PAR-CLIP	21572407
MIRT545111	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT545110	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT545109	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT1224113	hsa-miR-3646	CLIP-seq
MIRT1224114	hsa-miR-4678	CLIP-seq
MIRT1224115	hsa-miR-221	CLIP-seq
MIRT1224116	hsa-miR-222	CLIP-seq
MIRT1224117	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 609730
• HGNC: 30552
• e!Ensembl: ENSG00000165966

Protein

• UniProt ID: Q6ZMN7
• Protein name: PDZ domain-containing RING finger protein 4 (Ligand of Numb protein X 4) (SEMACAP3-like protein)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	224 → 311	PDZ domain	Domain
  PF00595	PDZ	402 → 485	PDZ domain	Domain
  PF13923	zf-C3HC4_2	17 → 56		Domain

• Sequence:

  MGFALERFAEAVDPALECKLCGQVLEEPLCTPCGHVFCASCLLPWAVRRRRCPLQCQPLA
  PGELYRVLPLRSLIQKLRVQCDYRARGCGHSVRLHELEAHVEHCDFGPARRLRSRGGCAS
  GLGGGEVPARGGCGPTPRAGRGGGARGGPPGGRWGRGRGPGPRVLAWRRREKALLAQLWA
  LQGEVQLTARRYQEKFTQYMAHVRNFVGDLGGGHRRDGEHKPFTIVLERENDTLGFNIIG
  GRPNQNNQEGTSTEGIYVSKILENGPADRADGLEIHDKIMEVNGKDLSKATHEEAVEAFR
  NAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLRPPTPPVPDIC
  PFLLSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKLGLTVCY
  RTDDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECKRIV
  LLVARPEIQLDEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTD
  TATSSSNNHEKDSGVGRTDESLRNDESSEQENAAEDPNSTSLKSKRDLGQSQDTLGSVEL
  QYNESLVSGEYIDSDCIGNPDEDCERFRQLLELKCKIRNHGEYDLYYSSSTIECNQGEQE
  GVEHELQLLNEELRNIELECQNIMQAHRLQKVTDQYGDIWTLHDGGFRNYNTSIDMQRGK
  LDDIMEHPEKSDKDSSSAYNTAESCRSTPLTVDRSPDSSLPRVINLTNKKNLRSTMAATQ
  SSSGQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRY
  ANIPAHARHYQSYMQLIQQKSAVEYAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRY
  ITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRRRR
  EFMMRSRLECLKESPQSGSEGKKEINIIELSHKKMMKKRNKKILDNWMTIQELMTHGAKS
  PDGTRVHNAFLSVTTV

• Sequence length: 1036

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (19)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	25918132	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE REMODELING DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARREST	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	38411962	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	38767906	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	GWAS catalog	30583798	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	35115687	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	19010793	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	35131881	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARENCHYMAL HEMATOMA	—	GWAS catalog	33723576	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 38374256, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR FIBRILLATION	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	GWASCAT_DG	25918132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	31320627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28350845	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26486104		★☆☆☆☆ Found in Text Mining only
Motion Sickness	Motion Sickness	GWASCAT_DG	25628336		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20944657		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	26486104		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TDRD15 2 shared diseasesErectile dysfunction, Neuroblastoma 2 shared evidence sourcesGWAS catalog (Erectile dysfunction), GWAS catalog (Neuroblastoma) Related via 2 shared diseases including Erectile dysfunction, Neuroblastoma — evidence mostly GWAS catalog. WDHD1 1 shared diseaseDry eye syndrome 2 shared evidence sourcesGWAS catalog (Astrocytoma), GWAS catalog (Dry eye syndrome) Related via 1 shared disease including Dry eye syndrome — evidence mostly GWAS catalog. KCNJ8 2 shared diseasesCardiac arrest, Ventricular fibrillation Related via 2 shared diseases including Cardiac arrest, Ventricular fibrillation. HSD17B12 1 shared diseaseNeuroblastoma 2 shared evidence sourcesGWAS catalog (Astrocytoma), GWAS catalog (Neuroblastoma) Related via 1 shared disease including Neuroblastoma — evidence mostly GWAS catalog. AKAP9 2 shared diseasesCardiac arrest, Ventricular fibrillation Related via 2 shared diseases including Cardiac arrest, Ventricular fibrillation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TDRD15	2	["Erectile dysfunction","Neuroblastoma"]	0	[]	2	["GWAS catalog (Erectile dysfunction)","GWAS catalog (Neuroblastoma)"]
WDHD1	1	["Dry eye syndrome"]	0	[]	2	["GWAS catalog (Astrocytoma)","GWAS catalog (Dry eye syndrome)"]
KCNJ8	2	["Cardiac arrest","Ventricular fibrillation"]	0	[]	0	[]
HSD17B12	1	["Neuroblastoma"]	0	[]	2	["GWAS catalog (Astrocytoma)","GWAS catalog (Neuroblastoma)"]
AKAP9	2	["Cardiac arrest","Ventricular fibrillation"]	0	[]	0	[]

Diseases Linked via Similar Genes

Cardiovascular disease Linked via 2 of 5 related genesTDRD15, HSD17B12 Coronary artery disease Linked via 2 of 5 related genesTDRD15, HSD17B12 Myocardial ischemia Linked via 2 of 5 related genesTDRD15, KCNJ8 Brugada syndrome Linked via 2 of 5 related genesKCNJ8, AKAP9 Long qt syndrome Linked via 2 of 5 related genesKCNJ8, AKAP9

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Cardiovascular disease	2	["TDRD15","HSD17B12"]
Coronary artery disease	2	["TDRD15","HSD17B12"]
Myocardial ischemia	2	["TDRD15","KCNJ8"]
Brugada syndrome	2	["KCNJ8","AKAP9"]
Long qt syndrome	2	["KCNJ8","AKAP9"]