PDLIM1 (PDZ and LIM domain 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9124
• Gene name: PDZ and LIM domain 1
• Gene symbol: PDLIM1
• Synonyms (NCBI Gene): CLIM1, CLP-36, CLP36, HEL-S-112, hCLIM1
• Chromosome: 10
• Chromosome location: 10q23.33
• Summary: This gene encodes a member of the enigma protein family. The protein contains two protein interacting domains, a PDZ domain at the amino terminal end and one to three LIM domains at the carboxyl terminal. It is a cytoplasmic protein associated with the cy

miRNA Show/Hide all (145)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029619	hsa-miR-26b-5p	Microarray	19088304
MIRT049434	hsa-miR-92a-3p	CLASH	23622248
MIRT044643	hsa-miR-320a	CLASH	23622248
MIRT041081	hsa-miR-504-5p	CLASH	23622248
MIRT1222072	hsa-miR-103a	CLIP-seq
MIRT1222073	hsa-miR-105	CLIP-seq
MIRT1222074	hsa-miR-107	CLIP-seq
MIRT1222075	hsa-miR-1253	CLIP-seq
MIRT1222076	hsa-miR-2964a-5p	CLIP-seq
MIRT1222077	hsa-miR-3117-5p	CLIP-seq
MIRT1222078	hsa-miR-3919	CLIP-seq
MIRT1222079	hsa-miR-4328	CLIP-seq
MIRT1222080	hsa-miR-4724-5p	CLIP-seq
MIRT1222081	hsa-miR-647	CLIP-seq
MIRT1222082	hsa-miR-922	CLIP-seq
MIRT1222072	hsa-miR-103a	CLIP-seq
MIRT1222073	hsa-miR-105	CLIP-seq
MIRT1222074	hsa-miR-107	CLIP-seq
MIRT1222075	hsa-miR-1253	CLIP-seq
MIRT2064346	hsa-miR-141	CLIP-seq
MIRT2064347	hsa-miR-200a	CLIP-seq
MIRT1222076	hsa-miR-2964a-5p	CLIP-seq
MIRT2064348	hsa-miR-3151	CLIP-seq
MIRT2064349	hsa-miR-3180	CLIP-seq
MIRT2064350	hsa-miR-3180-3p	CLIP-seq
MIRT2064351	hsa-miR-3196	CLIP-seq
MIRT2064352	hsa-miR-3671	CLIP-seq
MIRT1222078	hsa-miR-3919	CLIP-seq
MIRT2064353	hsa-miR-3940-5p	CLIP-seq
MIRT1222079	hsa-miR-4328	CLIP-seq
MIRT2064354	hsa-miR-4475	CLIP-seq
MIRT2064355	hsa-miR-4507	CLIP-seq
MIRT2064356	hsa-miR-509-3p	CLIP-seq
MIRT2064357	hsa-miR-607	CLIP-seq
MIRT1222081	hsa-miR-647	CLIP-seq
MIRT1222082	hsa-miR-922	CLIP-seq
MIRT1222072	hsa-miR-103a	CLIP-seq
MIRT1222073	hsa-miR-105	CLIP-seq
MIRT1222074	hsa-miR-107	CLIP-seq
MIRT2292658	hsa-miR-1184	CLIP-seq
MIRT2292659	hsa-miR-1207-3p	CLIP-seq
MIRT2292660	hsa-miR-1207-5p	CLIP-seq
MIRT1222075	hsa-miR-1253	CLIP-seq
MIRT2292661	hsa-miR-1287	CLIP-seq
MIRT2292662	hsa-miR-1321	CLIP-seq
MIRT2292663	hsa-miR-138	CLIP-seq
MIRT2292664	hsa-miR-2467-3p	CLIP-seq
MIRT1222076	hsa-miR-2964a-5p	CLIP-seq
MIRT2292665	hsa-miR-3135b	CLIP-seq
MIRT2292666	hsa-miR-3150b-3p	CLIP-seq
MIRT2292667	hsa-miR-320b	CLIP-seq
MIRT2292668	hsa-miR-320c	CLIP-seq
MIRT2292669	hsa-miR-320d	CLIP-seq
MIRT2292670	hsa-miR-335	CLIP-seq
MIRT2292671	hsa-miR-3545-5p	CLIP-seq
MIRT2292672	hsa-miR-3650	CLIP-seq
MIRT2064352	hsa-miR-3671	CLIP-seq
MIRT2292673	hsa-miR-370	CLIP-seq
MIRT2292674	hsa-miR-3714	CLIP-seq
MIRT1222078	hsa-miR-3919	CLIP-seq
MIRT2064353	hsa-miR-3940-5p	CLIP-seq
MIRT2292675	hsa-miR-4270	CLIP-seq
MIRT2292676	hsa-miR-4275	CLIP-seq
MIRT2292677	hsa-miR-4307	CLIP-seq
MIRT2292678	hsa-miR-4429	CLIP-seq
MIRT2292679	hsa-miR-4434	CLIP-seq
MIRT2292680	hsa-miR-4441	CLIP-seq
MIRT2064355	hsa-miR-4507	CLIP-seq
MIRT2292681	hsa-miR-4516	CLIP-seq
MIRT2292682	hsa-miR-4531	CLIP-seq
MIRT2292683	hsa-miR-4640-5p	CLIP-seq
MIRT2292684	hsa-miR-4652-5p	CLIP-seq
MIRT2292685	hsa-miR-4668-5p	CLIP-seq
MIRT2292686	hsa-miR-4726-5p	CLIP-seq
MIRT2292687	hsa-miR-4728-5p	CLIP-seq
MIRT2292688	hsa-miR-4739	CLIP-seq
MIRT2292689	hsa-miR-4756-5p	CLIP-seq
MIRT2292690	hsa-miR-4763-3p	CLIP-seq
MIRT2292691	hsa-miR-4773	CLIP-seq
MIRT2292692	hsa-miR-4784	CLIP-seq
MIRT2292693	hsa-miR-498	CLIP-seq
MIRT2064356	hsa-miR-509-3p	CLIP-seq
MIRT2292694	hsa-miR-548aa	CLIP-seq
MIRT2064357	hsa-miR-607	CLIP-seq
MIRT1222081	hsa-miR-647	CLIP-seq
MIRT1222082	hsa-miR-922	CLIP-seq
MIRT2292695	hsa-miR-940	CLIP-seq
MIRT2292664	hsa-miR-2467-3p	CLIP-seq
MIRT2456140	hsa-miR-3973	CLIP-seq
MIRT2292685	hsa-miR-4668-5p	CLIP-seq
MIRT2456141	hsa-miR-548a-5p	CLIP-seq
MIRT2292694	hsa-miR-548aa	CLIP-seq
MIRT2456142	hsa-miR-548ab	CLIP-seq
MIRT2456143	hsa-miR-548ak	CLIP-seq
MIRT2456144	hsa-miR-548b-5p	CLIP-seq
MIRT2456145	hsa-miR-548c-5p	CLIP-seq
MIRT2456146	hsa-miR-548d-5p	CLIP-seq
MIRT2456147	hsa-miR-548h	CLIP-seq
MIRT2456148	hsa-miR-548i	CLIP-seq
MIRT2456149	hsa-miR-548j	CLIP-seq
MIRT2456150	hsa-miR-548w	CLIP-seq
MIRT2456151	hsa-miR-548y	CLIP-seq
MIRT2456152	hsa-miR-559	CLIP-seq
MIRT2292664	hsa-miR-2467-3p	CLIP-seq
MIRT2456140	hsa-miR-3973	CLIP-seq
MIRT2292685	hsa-miR-4668-5p	CLIP-seq
MIRT2456141	hsa-miR-548a-5p	CLIP-seq
MIRT2292694	hsa-miR-548aa	CLIP-seq
MIRT2456142	hsa-miR-548ab	CLIP-seq
MIRT2456143	hsa-miR-548ak	CLIP-seq
MIRT2456144	hsa-miR-548b-5p	CLIP-seq
MIRT2456145	hsa-miR-548c-5p	CLIP-seq
MIRT2456146	hsa-miR-548d-5p	CLIP-seq
MIRT2456147	hsa-miR-548h	CLIP-seq
MIRT2456148	hsa-miR-548i	CLIP-seq
MIRT2456149	hsa-miR-548j	CLIP-seq
MIRT2456150	hsa-miR-548w	CLIP-seq
MIRT2456151	hsa-miR-548y	CLIP-seq
MIRT2456152	hsa-miR-559	CLIP-seq
MIRT1222072	hsa-miR-103a	CLIP-seq
MIRT1222073	hsa-miR-105	CLIP-seq
MIRT1222074	hsa-miR-107	CLIP-seq
MIRT1222075	hsa-miR-1253	CLIP-seq
MIRT1222076	hsa-miR-2964a-5p	CLIP-seq
MIRT1222077	hsa-miR-3117-5p	CLIP-seq
MIRT2064348	hsa-miR-3151	CLIP-seq
MIRT2064349	hsa-miR-3180	CLIP-seq
MIRT2064350	hsa-miR-3180-3p	CLIP-seq
MIRT2064351	hsa-miR-3196	CLIP-seq
MIRT2064352	hsa-miR-3671	CLIP-seq
MIRT1222078	hsa-miR-3919	CLIP-seq
MIRT2064353	hsa-miR-3940-5p	CLIP-seq
MIRT1222079	hsa-miR-4328	CLIP-seq
MIRT2064355	hsa-miR-4507	CLIP-seq
MIRT1222080	hsa-miR-4724-5p	CLIP-seq
MIRT2064356	hsa-miR-509-3p	CLIP-seq
MIRT2064357	hsa-miR-607	CLIP-seq
MIRT1222081	hsa-miR-647	CLIP-seq
MIRT1222082	hsa-miR-922	CLIP-seq
MIRT2292659	hsa-miR-1207-3p	CLIP-seq
MIRT2292663	hsa-miR-138	CLIP-seq
MIRT1222077	hsa-miR-3117-5p	CLIP-seq
MIRT2292672	hsa-miR-3650	CLIP-seq
MIRT1222079	hsa-miR-4328	CLIP-seq
MIRT1222080	hsa-miR-4724-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001725	Component	Stress fiber	IBA
GO:0001725	Component	Stress fiber	IDA	11110697
GO:0001725	Component	Stress fiber	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005515	Function	Protein binding	IPI	10753915, 10861853, 11110697, 16189514, 28514442, 29892012, 31515488, 33961781, 35271311
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IDA	10861853, 11110697
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IDA	10861853, 11110697
GO:0005856	Component	Cytoskeleton	IEA
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0005912	Component	Adherens junction	IBA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006979	Process	Response to oxidative stress	TAS	8522188
GO:0007507	Process	Heart development	IBA
GO:0010761	Process	Fibroblast migration	IEA
GO:0010761	Process	Fibroblast migration	ISS
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0030011	Process	Maintenance of cell polarity	IEA
GO:0030011	Process	Maintenance of cell polarity	ISS
GO:0030018	Component	Z disc	IBA
GO:0030018	Component	Z disc	IDA	10861853
GO:0030018	Component	Z disc	IEA
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030950	Process	Establishment or maintenance of actin cytoskeleton polarity	IEA
GO:0030950	Process	Establishment or maintenance of actin cytoskeleton polarity	ISS
GO:0031941	Component	Filamentous actin	IBA
GO:0043149	Process	Stress fiber assembly	IEA
GO:0043149	Process	Stress fiber assembly	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051371	Function	Muscle alpha-actinin binding	IBA
GO:0061061	Process	Muscle structure development	IBA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996

Other IDs

• MIM: 605900
• HGNC: 2067
• e!Ensembl: ENSG00000107438

Protein

• UniProt ID: O00151
• Protein name: PDZ and LIM domain protein 1 (C-terminal LIM domain protein 1) (Elfin) (LIM domain protein CLP-36)
• Protein function: Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton (PubMed:10861853). Involved in assembly, disassembly and directioning of stress fibers in fibroblasts. Required for the localization of
• PDB: 1X62 , 2PKT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	260 → 314	LIM domain	Domain
  PF00595	PDZ	3 → 82	PDZ domain	Domain
  PF15936	DUF4749	138 → 236	Domain of unknown function (DUF4749)	Family

• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in the heart and skeletal muscle, moderately expressed in the spleen, small intestine, colon, placenta, and lung. A lower level expression is seen in liver, thymus, kidney, prostate and pancreas and is not found in t
• Sequence:

  MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSN
  MTHLEAQNRIKGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAH
  NRSAMPFTASPASSTTARVITNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPLD
  HAQPPSSLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSV
  KAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFF
  VEDQIYCEKHARERVTPPEGYEVVTVFPK

• Sequence length: 329

Pathways

KEGG Pathway:

Cytoskeleton in muscle cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Hepatocellular carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (37)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atherosclerosis	Atherosclerosis	Pubtator	40404675	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	21651830	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21651830		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24662836, 27068564		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	39735560	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	40404675	Associate	★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	17625998		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	17625998, 22691402		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23546957		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	12080386		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36175575	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34545296	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36677861	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	21680739		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	27078885		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26119933		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26863628	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26119933		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26119933		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	36175575	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	36175575	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31509262		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37414929	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	37414929	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	39735560	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24662836, 27068564		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30582284		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24662836		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	36175575	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23546957	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34489945	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36175575	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35707002	Inhibit	★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	21680739		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	24738046	Associate	★☆☆☆☆ Found in Text Mining only
Supravalvular aortic stenosis	Supravalvar aortic stenosis	BEFREE	12080386		★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	12080386, 28691460		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PDLIM1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PDLIM1.