Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10954
Gene name	Protein disulfide isomerase family A member 5
Gene symbol	PDIA5
Synonyms (NCBI Gene)	PDIR
Chromosome	3
Chromosome location	3q21.1
Summary	This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, three catalyticall

28 Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029455	hsa-miR-26b-5p	Microarray	19088304
MIRT471452	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT471451	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT471450	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT471449	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT471448	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT471447	hsa-miR-382-3p	PAR-CLIP	23592263
MIRT471446	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT471445	hsa-miR-3148	PAR-CLIP	23592263
MIRT471444	hsa-miR-6124	PAR-CLIP	23592263
MIRT471443	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT471452	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT471451	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT471450	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT471449	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT471448	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT471447	hsa-miR-382-3p	PAR-CLIP	23592263
MIRT471446	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT471445	hsa-miR-3148	PAR-CLIP	23592263
MIRT471444	hsa-miR-6124	PAR-CLIP	23592263
MIRT471443	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT1221486	hsa-miR-128	CLIP-seq
MIRT1221487	hsa-miR-27a	CLIP-seq
MIRT1221488	hsa-miR-27b	CLIP-seq
MIRT1221489	hsa-miR-3065-5p	CLIP-seq
MIRT1221490	hsa-miR-3190	CLIP-seq
MIRT1221491	hsa-miR-4491	CLIP-seq
MIRT1221492	hsa-miR-4657	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003756	Function	Protein disulfide isomerase activity	IBA
GO:0003756	Function	Protein disulfide isomerase activity	IDA	14627699
GO:0003756	Function	Protein disulfide isomerase activity	IEA
GO:0003756	Function	Protein disulfide isomerase activity	TAS	7556671
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS	7556671
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	14627699
GO:0006457	Process	Protein folding	TAS	7556671
GO:0015035	Function	Protein-disulfide reductase activity	IDA	16677074
GO:0016491	Function	Oxidoreductase activity	TAS	7556671
GO:0016853	Function	Isomerase activity	IEA
GO:0022900	Process	Electron transport chain	TAS	7556671

MIM	HGNC	e!Ensembl
616942	24811	ENSG00000065485

Q14554

Protein name

Protein disulfide-isomerase A5 (EC 5.3.4.1) (Protein disulfide isomerase-related protein)

PDB

4I6X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00085	Thioredoxin	277 → 381	Thioredoxin	Domain
PF00085	Thioredoxin	398 → 503	Thioredoxin	Domain
PF00085	Thioredoxin	153 → 258	Thioredoxin	Domain

Sequence

MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAA
ENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYH
YGKFAEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL

Sequence length

519

Interactions

View interactions

Reactome Pathway
XBP1(S) activates chaperone genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38685053	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	25118708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28487959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36445533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28487959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	25118708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	21655191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	25118708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32023222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33664747	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28487959		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	29507125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28487959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	25118708		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with PDIA5 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PDIA5.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PDIA5 (see Related Genes above), that are NOT already directly curated for PDIA5 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PDIA5.

PDIA5 (protein disulfide isomerase family A member 5)

Save This Analysis