Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	11235
Gene name	Programmed cell death 10
Gene symbol	PDCD10
Synonyms (NCBI Gene)	CCM3TFAR15
Chromosome	3
Chromosome location	3q26.1
Summary	This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is ph

Show/Hide all (29)

SNP ID	Visualize variation	Clinical significance	Consequence
rs886041888	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1057517786	G>A	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1303470125	G>A,C	Pathogenic	Missense variant, stop gained, coding sequence variant
rs1357917630	G>A	Pathogenic	Stop gained, coding sequence variant
rs1404676956	G>A	Pathogenic	Coding sequence variant, stop gained
rs1553758385	T>A,G	Uncertain-significance, likely-pathogenic	Splice acceptor variant
rs1553759042	ACTT>-	Pathogenic	Splice donor variant, intron variant, coding sequence variant
rs1553759059	G>C	Pathogenic, likely-pathogenic	Stop gained, coding sequence variant
rs1553759139	C>T	Pathogenic, likely-pathogenic	Intron variant
rs1553760888	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1553760900	G>A	Pathogenic	Stop gained, coding sequence variant
rs1553761217	C>T	Pathogenic	Splice donor variant
rs1553761266	CTTT>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1553762839	C>A,T	Likely-pathogenic	Splice donor variant
rs1559941951	->A	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1559944592	A>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1559944602	C>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1559945126	T>A	Likely-pathogenic	Splice acceptor variant
rs1559945136	G>C	Pathogenic	Intron variant
rs1559952217	A>C	Likely-pathogenic	Splice donor variant
rs1559952220	C>T	Likely-pathogenic	Splice donor variant
rs1559952317	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1559952461	CT>-	Likely-pathogenic	Splice acceptor variant, coding sequence variant
rs1559952467	C>G	Likely-pathogenic	Splice acceptor variant
rs1559953791	C>-	Likely-pathogenic	Splice donor variant, coding sequence variant
rs1559960758	A>-	Likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1577317859	C>T	Pathogenic	Splice acceptor variant
rs1577329627	T>A	Pathogenic	Stop gained, coding sequence variant
rs1577329665	G>A	Pathogenic	Stop gained, coding sequence variant

326

Show/Hide all (326)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020819	hsa-miR-155-5p	Proteomics	18668040
MIRT023428	hsa-miR-30b-5p	Sequencing	20371350
MIRT023815	hsa-miR-1-3p	Proteomics	18668040
MIRT023815	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT028601	hsa-miR-30a-5p	Proteomics	18668040
MIRT032330	hsa-let-7b-5p	Proteomics	18668040
MIRT522007	hsa-miR-8485	HITS-CLIP	21572407
MIRT522006	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT522005	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT522004	hsa-miR-603	HITS-CLIP	21572407
MIRT522003	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT522002	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT522001	hsa-miR-26b-3p	HITS-CLIP	21572407
MIRT707975	hsa-miR-3182	HITS-CLIP	21572407
MIRT707974	hsa-miR-6740-3p	HITS-CLIP	21572407
MIRT522000	hsa-miR-1206	HITS-CLIP	21572407
MIRT521999	hsa-miR-6853-3p	HITS-CLIP	21572407
MIRT521998	hsa-miR-3941	HITS-CLIP	21572407
MIRT521997	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT521996	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521995	hsa-miR-5007-3p	HITS-CLIP	21572407
MIRT521994	hsa-miR-4652-3p	HITS-CLIP	21572407
MIRT521993	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT522007	hsa-miR-8485	HITS-CLIP	23824327
MIRT522006	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT522005	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT522004	hsa-miR-603	HITS-CLIP	23824327
MIRT522003	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT522002	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521998	hsa-miR-3941	HITS-CLIP	23824327
MIRT521997	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT521996	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT521993	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT555756	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT555755	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT555754	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT028601	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT023428	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT555753	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT555752	hsa-miR-3133	PAR-CLIP	21572407
MIRT555751	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT555750	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT555749	hsa-miR-5683	PAR-CLIP	21572407
MIRT555748	hsa-miR-5680	PAR-CLIP	21572407
MIRT555747	hsa-miR-586	PAR-CLIP	21572407
MIRT555746	hsa-miR-4495	PAR-CLIP	21572407
MIRT555745	hsa-miR-5697	PAR-CLIP	21572407
MIRT555744	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT555743	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT555742	hsa-miR-1297	PAR-CLIP	21572407
MIRT555741	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT555740	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT555739	hsa-miR-4465	PAR-CLIP	21572407
MIRT555738	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT555737	hsa-miR-3064-3p	PAR-CLIP	21572407
MIRT555736	hsa-miR-4715-3p	PAR-CLIP	21572407
MIRT555735	hsa-miR-2053	PAR-CLIP	21572407
MIRT555734	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT555733	hsa-miR-498	PAR-CLIP	21572407
MIRT208901	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT555732	hsa-miR-1305	PAR-CLIP	21572407
MIRT555731	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT522007	hsa-miR-8485	PAR-CLIP	21572407
MIRT522006	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT522005	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT522004	hsa-miR-603	PAR-CLIP	21572407
MIRT522003	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT522002	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521998	hsa-miR-3941	PAR-CLIP	21572407
MIRT521997	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT521996	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521993	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT522007	hsa-miR-8485	PAR-CLIP	21572407
MIRT522006	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT522005	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT522004	hsa-miR-603	PAR-CLIP	21572407
MIRT522003	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT522002	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521998	hsa-miR-3941	PAR-CLIP	21572407
MIRT521997	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT521996	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521993	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT522007	hsa-miR-8485	PAR-CLIP	23446348
MIRT522006	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT522005	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT522004	hsa-miR-603	PAR-CLIP	23446348
MIRT522003	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT522002	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522001	hsa-miR-26b-3p	PAR-CLIP	23446348
MIRT522000	hsa-miR-1206	PAR-CLIP	23446348
MIRT521999	hsa-miR-6853-3p	PAR-CLIP	23446348
MIRT521998	hsa-miR-3941	PAR-CLIP	23446348
MIRT521997	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT521996	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT521995	hsa-miR-5007-3p	PAR-CLIP	23446348
MIRT521994	hsa-miR-4652-3p	PAR-CLIP	23446348
MIRT521993	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT731465	hsa-miR-425-5p	Luciferase reporter assay	27132035
MIRT731465	hsa-miR-425-5p	Luciferase reporter assayWestern blot	26647742
MIRT731465	hsa-miR-425-5p	Luciferase reporter assayWestern blot	26647742
MIRT733398	hsa-miR-222-3p	ChIP-seqImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	32483426
MIRT522007	hsa-miR-8485	HITS-CLIP	21572407
MIRT522006	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT522005	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT522004	hsa-miR-603	HITS-CLIP	21572407
MIRT522003	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT522002	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT522001	hsa-miR-26b-3p	HITS-CLIP	21572407
MIRT707975	hsa-miR-3182	HITS-CLIP	21572407
MIRT707974	hsa-miR-6740-3p	HITS-CLIP	21572407
MIRT522000	hsa-miR-1206	HITS-CLIP	21572407
MIRT521999	hsa-miR-6853-3p	HITS-CLIP	21572407
MIRT521998	hsa-miR-3941	HITS-CLIP	21572407
MIRT521997	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT521996	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521995	hsa-miR-5007-3p	HITS-CLIP	21572407
MIRT521994	hsa-miR-4652-3p	HITS-CLIP	21572407
MIRT521993	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT522007	hsa-miR-8485	HITS-CLIP	23824327
MIRT522006	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT522005	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT522004	hsa-miR-603	HITS-CLIP	23824327
MIRT522003	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT522002	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521998	hsa-miR-3941	HITS-CLIP	23824327
MIRT521997	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT521996	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT521993	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT555756	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT555755	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT555754	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT028601	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT023428	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT555753	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT555752	hsa-miR-3133	PAR-CLIP	21572407
MIRT555751	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT555750	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT555749	hsa-miR-5683	PAR-CLIP	21572407
MIRT555748	hsa-miR-5680	PAR-CLIP	21572407
MIRT555747	hsa-miR-586	PAR-CLIP	21572407
MIRT555746	hsa-miR-4495	PAR-CLIP	21572407
MIRT555745	hsa-miR-5697	PAR-CLIP	21572407
MIRT555744	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT555743	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT555742	hsa-miR-1297	PAR-CLIP	21572407
MIRT555741	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT555740	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT555739	hsa-miR-4465	PAR-CLIP	21572407
MIRT555738	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT555737	hsa-miR-3064-3p	PAR-CLIP	21572407
MIRT555736	hsa-miR-4715-3p	PAR-CLIP	21572407
MIRT555735	hsa-miR-2053	PAR-CLIP	21572407
MIRT555734	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT555733	hsa-miR-498	PAR-CLIP	21572407
MIRT208901	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT555732	hsa-miR-1305	PAR-CLIP	21572407
MIRT555731	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT522007	hsa-miR-8485	PAR-CLIP	21572407
MIRT522006	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT522005	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT522004	hsa-miR-603	PAR-CLIP	21572407
MIRT522003	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT522002	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521998	hsa-miR-3941	PAR-CLIP	21572407
MIRT521997	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT521996	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521993	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT522007	hsa-miR-8485	PAR-CLIP	21572407
MIRT522006	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT522005	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT522004	hsa-miR-603	PAR-CLIP	21572407
MIRT522003	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT522002	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521998	hsa-miR-3941	PAR-CLIP	21572407
MIRT521997	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT521996	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521993	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT522007	hsa-miR-8485	PAR-CLIP	23446348
MIRT522006	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT522005	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT522004	hsa-miR-603	PAR-CLIP	23446348
MIRT522003	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT522002	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522001	hsa-miR-26b-3p	PAR-CLIP	23446348
MIRT522000	hsa-miR-1206	PAR-CLIP	23446348
MIRT521999	hsa-miR-6853-3p	PAR-CLIP	23446348
MIRT521998	hsa-miR-3941	PAR-CLIP	23446348
MIRT521997	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT521996	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT521995	hsa-miR-5007-3p	PAR-CLIP	23446348
MIRT521994	hsa-miR-4652-3p	PAR-CLIP	23446348
MIRT521993	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1219157	hsa-miR-1	CLIP-seq
MIRT1219158	hsa-miR-103a	CLIP-seq
MIRT1219159	hsa-miR-107	CLIP-seq
MIRT1219160	hsa-miR-1301	CLIP-seq
MIRT1219161	hsa-miR-206	CLIP-seq
MIRT1219162	hsa-miR-221	CLIP-seq
MIRT1219163	hsa-miR-222	CLIP-seq
MIRT1219164	hsa-miR-26a	CLIP-seq
MIRT1219165	hsa-miR-26b	CLIP-seq
MIRT1219166	hsa-miR-323-3p	CLIP-seq
MIRT1219167	hsa-miR-3662	CLIP-seq
MIRT1219168	hsa-miR-410	CLIP-seq
MIRT1219169	hsa-miR-425	CLIP-seq
MIRT1219170	hsa-miR-4302	CLIP-seq
MIRT1219171	hsa-miR-4315	CLIP-seq
MIRT1219172	hsa-miR-4426	CLIP-seq
MIRT1219173	hsa-miR-4647	CLIP-seq
MIRT1219174	hsa-miR-4662b	CLIP-seq
MIRT1219175	hsa-miR-4790-5p	CLIP-seq
MIRT1219176	hsa-miR-5047	CLIP-seq
MIRT1219177	hsa-miR-520d-5p	CLIP-seq
MIRT1219178	hsa-miR-524-3p	CLIP-seq
MIRT1219179	hsa-miR-524-5p	CLIP-seq
MIRT1219180	hsa-miR-525-3p	CLIP-seq
MIRT1219181	hsa-miR-613	CLIP-seq
MIRT1219182	hsa-miR-642b	CLIP-seq
MIRT1219183	hsa-miR-374a	CLIP-seq
MIRT1219184	hsa-miR-374b	CLIP-seq
MIRT1219178	hsa-miR-524-3p	CLIP-seq
MIRT1219180	hsa-miR-525-3p	CLIP-seq
MIRT2063375	hsa-miR-200b	CLIP-seq
MIRT2063376	hsa-miR-200c	CLIP-seq
MIRT2063377	hsa-miR-429	CLIP-seq
MIRT1219158	hsa-miR-103a	CLIP-seq
MIRT1219159	hsa-miR-107	CLIP-seq
MIRT2291828	hsa-miR-1253	CLIP-seq
MIRT1219160	hsa-miR-1301	CLIP-seq
MIRT2063375	hsa-miR-200b	CLIP-seq
MIRT2063376	hsa-miR-200c	CLIP-seq
MIRT2291829	hsa-miR-2682	CLIP-seq
MIRT2291830	hsa-miR-300	CLIP-seq
MIRT2291831	hsa-miR-3126-5p	CLIP-seq
MIRT2291832	hsa-miR-3143	CLIP-seq
MIRT2291833	hsa-miR-3199	CLIP-seq
MIRT1219166	hsa-miR-323-3p	CLIP-seq
MIRT2291834	hsa-miR-3714	CLIP-seq
MIRT2291835	hsa-miR-381	CLIP-seq
MIRT1219169	hsa-miR-425	CLIP-seq
MIRT2291836	hsa-miR-4251	CLIP-seq
MIRT2291837	hsa-miR-4252	CLIP-seq
MIRT2291838	hsa-miR-4282	CLIP-seq
MIRT2063377	hsa-miR-429	CLIP-seq
MIRT2291839	hsa-miR-4484	CLIP-seq
MIRT2291840	hsa-miR-449c	CLIP-seq
MIRT2291841	hsa-miR-4666-3p	CLIP-seq
MIRT2291842	hsa-miR-4740-5p	CLIP-seq
MIRT2291843	hsa-miR-4803	CLIP-seq
MIRT1219176	hsa-miR-5047	CLIP-seq
MIRT1219178	hsa-miR-524-3p	CLIP-seq
MIRT1219180	hsa-miR-525-3p	CLIP-seq
MIRT2291844	hsa-miR-548an	CLIP-seq
MIRT2291845	hsa-miR-577	CLIP-seq
MIRT1219182	hsa-miR-642b	CLIP-seq
MIRT2291828	hsa-miR-1253	CLIP-seq
MIRT2589506	hsa-miR-186	CLIP-seq
MIRT2063375	hsa-miR-200b	CLIP-seq
MIRT2063376	hsa-miR-200c	CLIP-seq
MIRT1219162	hsa-miR-221	CLIP-seq
MIRT1219163	hsa-miR-222	CLIP-seq
MIRT2291829	hsa-miR-2682	CLIP-seq
MIRT2291832	hsa-miR-3143	CLIP-seq
MIRT2589507	hsa-miR-3609	CLIP-seq
MIRT2291834	hsa-miR-3714	CLIP-seq
MIRT1219183	hsa-miR-374a	CLIP-seq
MIRT1219184	hsa-miR-374b	CLIP-seq
MIRT2291836	hsa-miR-4251	CLIP-seq
MIRT2291837	hsa-miR-4252	CLIP-seq
MIRT2589508	hsa-miR-4276	CLIP-seq
MIRT2291838	hsa-miR-4282	CLIP-seq
MIRT2063377	hsa-miR-429	CLIP-seq
MIRT1219170	hsa-miR-4302	CLIP-seq
MIRT1219172	hsa-miR-4426	CLIP-seq
MIRT2291839	hsa-miR-4484	CLIP-seq
MIRT2291840	hsa-miR-449c	CLIP-seq
MIRT1219173	hsa-miR-4647	CLIP-seq
MIRT1219174	hsa-miR-4662b	CLIP-seq
MIRT2291843	hsa-miR-4803	CLIP-seq
MIRT1219177	hsa-miR-520d-5p	CLIP-seq
MIRT1219178	hsa-miR-524-3p	CLIP-seq
MIRT1219179	hsa-miR-524-5p	CLIP-seq
MIRT1219180	hsa-miR-525-3p	CLIP-seq
MIRT2589509	hsa-miR-548ah	CLIP-seq
MIRT2291844	hsa-miR-548an	CLIP-seq
MIRT2589510	hsa-miR-548p	CLIP-seq
MIRT2589511	hsa-miR-548t	CLIP-seq
MIRT2291845	hsa-miR-577	CLIP-seq
MIRT1219182	hsa-miR-642b	CLIP-seq
MIRT2291828	hsa-miR-1253	CLIP-seq
MIRT2589506	hsa-miR-186	CLIP-seq
MIRT2063375	hsa-miR-200b	CLIP-seq
MIRT2063376	hsa-miR-200c	CLIP-seq
MIRT1219162	hsa-miR-221	CLIP-seq
MIRT1219163	hsa-miR-222	CLIP-seq
MIRT2291829	hsa-miR-2682	CLIP-seq
MIRT2291830	hsa-miR-300	CLIP-seq
MIRT2291832	hsa-miR-3143	CLIP-seq
MIRT2589507	hsa-miR-3609	CLIP-seq
MIRT2291834	hsa-miR-3714	CLIP-seq
MIRT1219183	hsa-miR-374a	CLIP-seq
MIRT1219184	hsa-miR-374b	CLIP-seq
MIRT2291835	hsa-miR-381	CLIP-seq
MIRT2291836	hsa-miR-4251	CLIP-seq
MIRT2291837	hsa-miR-4252	CLIP-seq
MIRT2589508	hsa-miR-4276	CLIP-seq
MIRT2291838	hsa-miR-4282	CLIP-seq
MIRT2063377	hsa-miR-429	CLIP-seq
MIRT1219170	hsa-miR-4302	CLIP-seq
MIRT1219172	hsa-miR-4426	CLIP-seq
MIRT2291839	hsa-miR-4484	CLIP-seq
MIRT2291840	hsa-miR-449c	CLIP-seq
MIRT1219173	hsa-miR-4647	CLIP-seq
MIRT1219174	hsa-miR-4662b	CLIP-seq
MIRT2291841	hsa-miR-4666-3p	CLIP-seq
MIRT2291843	hsa-miR-4803	CLIP-seq
MIRT1219177	hsa-miR-520d-5p	CLIP-seq
MIRT1219178	hsa-miR-524-3p	CLIP-seq
MIRT1219179	hsa-miR-524-5p	CLIP-seq
MIRT1219180	hsa-miR-525-3p	CLIP-seq
MIRT2589509	hsa-miR-548ah	CLIP-seq
MIRT2291844	hsa-miR-548an	CLIP-seq
MIRT2589510	hsa-miR-548p	CLIP-seq
MIRT2589511	hsa-miR-548t	CLIP-seq
MIRT2291845	hsa-miR-577	CLIP-seq
MIRT1219182	hsa-miR-642b	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0003158	Process	Endothelium development	NAS	17657516
GO:0005515	Function	Protein binding	IPI	16189514, 17360971, 17657516, 18782753, 20332113, 20489202, 21516116, 21561863, 22652780, 23266514, 23455922, 23541896, 23665169, 24366813, 25416956, 26496610, 27807006, 28514442, 31515488, 32296183, 32707033, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	22652780
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	22652780
GO:0005794	Component	Golgi apparatus	IDA	20332113
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	17360971, 20489202
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	17360971, 23541896
GO:0010628	Process	Positive regulation of gene expression	IMP	23388056
GO:0010629	Process	Negative regulation of gene expression	IMP	23388056
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	23541896
GO:0030335	Process	Positive regulation of cell migration	IMP	20332113
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IDA	22652780
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	20332113
GO:0035023	Process	Regulation of Rho protein signal transduction	IMP	20332113
GO:0035556	Process	Intracellular signal transduction	IMP	22291017
GO:0036481	Process	Intrinsic apoptotic signaling pathway in response to hydrogen peroxide	IGI	22652780
GO:0042803	Function	Protein homodimerization activity	IPI	20489202, 21561863
GO:0043066	Process	Negative regulation of apoptotic process	IDA	17360971
GO:0043149	Process	Stress fiber assembly	IMP	20332113
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	17360971
GO:0044319	Process	Wound healing, spreading of cells	IMP	20332113
GO:0045747	Process	Positive regulation of Notch signaling pathway	IMP	23388056
GO:0045765	Process	Regulation of angiogenesis	NAS	17657516
GO:0050821	Process	Protein stabilization	IMP	20332113, 22652780
GO:0051683	Process	Establishment of Golgi localization	IMP	20332113
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IMP	20332113
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IMP	23388056
GO:0090168	Process	Golgi reassembly	IBA
GO:0090168	Process	Golgi reassembly	IMP	20332113
GO:0090316	Process	Positive regulation of intracellular protein transport	IMP	27807006
GO:0090443	Component	FAR/SIN/STRIPAK complex	IBA
GO:0090443	Component	FAR/SIN/STRIPAK complex	IDA	18782753
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IMP	23388056
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
609118	8761	ENSG00000114209

Q9BUL8

Protein name

Programmed cell death protein 10 (Cerebral cavernous malformations 3 protein) (TF-1 cell apoptosis-related protein 15)

Protein function

Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity (PubMed:27807006). Important for cell migration, and for normal structure and assembly of the Golgi complex (PubMed

PDB

3AJM , 3L8I , 3L8J , 3RQE , 3RQF , 3RQG , 3W8H , 3W8I , 4GEH , 4TVQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06840	DUF1241	14 → 161		Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15543491}.

Sequence

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQ
DIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDE
INDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKT
YFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Sequence length

212

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cavernous hemangioma	Likely pathogenic; Pathogenic	rs1553759139	RCV000626904	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebral arteriovenous malformation	Likely pathogenic; Pathogenic	rs1553759139	RCV000626904	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebral cavernous malformation	Pathogenic; Likely pathogenic	rs1057517786, rs1559941951, rs1719762092	RCV001727711 RCV001727795 RCV004783908	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebral cavernous malformation 1	Pathogenic	rs2108438340	RCV001823320	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebral cavernous malformation 3	Pathogenic; Likely pathogenic	rs1559952317, rs2108363227, rs1553758385, rs2108409355, rs747383685, rs2108373966, rs2108375192, rs2108409560, rs2108409609, rs2108403745, rs2108484048, rs2108409594, rs2108438340, rs976585767, rs1577329665 View all (29 more)	RCV001375932 RCV001388666 RCV001389091 RCV001390464 RCV003600420 View all (44 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hemiparesis	Likely pathogenic; Pathogenic	rs1553759139	RCV000626904	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary cavernous hemangioma of brain	Likely pathogenic; Pathogenic	rs1553759139	RCV003380616	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PDCD10-related disorder	Pathogenic; Likely pathogenic	rs2108409609, rs1719758355, rs1553759139, rs1553760900, rs1357917630	RCV004741133 RCV003397257 RCV005429025 RCV003419967 RCV004740429	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Seizure	Likely pathogenic; Pathogenic	rs1553759139	RCV000626904	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTERIOVENOUS MALFORMATIONS, CEREBRAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAVERNOUS HEMANGIOMA OF BRAIN	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL CAVERNOUS MALFORMATIONS 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL CAVERNOUS MALFORMATIONS 3	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CEREBRAL ANEURYSM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL MALFORMATION OF CEREBRAL VESSELS NOS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL VENOUS ANOMALY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL CEREBRAL CAVERNOUS MALFORMATION	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILILAL CEREBRAL CAVERNOUS MALFORMATIONS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (66)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30272373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	17212813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19442737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Stem Neoplasms	Brain stem neoplasms	Pubtator	36629374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30408026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30653426, 35431232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30272373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	39212293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cavernous hemangioma of retina	Cavernous Hemangioma Of Retina	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Cavernous Malformations 1	Cerebral Cavernous Malformation	BEFREE	22378217, 27737651, 30314744		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL CAVERNOUS MALFORMATIONS 2	Cerebral Cavernous Malformation	BEFREE	17041941, 21029238, 22378217, 23000020, 23485406, 23748444, 24058906, 26122242, 26417067, 27737651, 30314744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Cavernous Malformations 3	Cerebral Cavernous Malformation	CLINVAR_DG	15543491, 18035376, 23485406, 23595507, 23801932, 25354366, 26896283		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Cavernous Malformations 3	Cerebral Cavernous Malformation	GENOMICS_ENGLAND_DG	15543491		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Cavernous Malformations 3	Cerebral Cavernous Malformation	BEFREE	17657516, 18300272, 19246713, 22378217, 23748444, 24058906, 25900426, 26122242, 28285997, 30208312, 30314744, 30476961, 31369819		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Cavernous Malformations 3	Cerebral cavernous malformation	Pubtator	19246713, 20854465, 23665169, 26385474, 32186778	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Cavernous Malformations 3	Cerebral Cavernous Malformation	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	20854465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25825518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Trauma	Cerebrovascular trauma	Pubtator	23388056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37781039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	19442737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31728833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	26490252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	26490252	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cerebral cavernous malformation	Cerebral Cavernous Malformation	GENOMICS_ENGLAND_DG	15543491		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cerebral cavernous malformation	Cerebral Cavernous Malformation	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cerebral cavernous malformation	Cerebral cavernous malformation	Pubtator	23388056, 25525273, 36629374, 38420834	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cerebral cavernous malformation	Cerebral Cavernous Malformation	BEFREE	28160210		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	26254477, 26490252, 30392087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26490252	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39273014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26254477, 26490252, 30392087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma of choroid	Hemangioma Of Choroid	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma, Cavernous	Hemangioma, Cavernous	BEFREE	31261134, 31446620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma, Cavernous	Hemangioma, Cavernous	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	33891857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	23541896, 24684205, 25825518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	28602929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	19442737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30408026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26771762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30272373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20854465, 29482058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	26246098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma familial	Meningioma	Pubtator	26246098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	35858850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26254477, 26490252, 28371279, 28734041, 30392087		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	25825518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroma	Neuroma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28734041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	39212293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26771762		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	25550858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25550858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23541896, 25825518, 26246098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	20854465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	20854465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases, Vascular	Skin Diseases, Vascular	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	32450789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23665169, 25825518, 28181149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

PDCD10 (programmed cell death 10)