PDC (phosducin)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5132
• Gene name: Phosducin
• Gene symbol: PDC
• Synonyms (NCBI Gene): MEKA, PHD, PhLOP, PhLP
• Chromosome: 1
• Chromosome location: 1q31.1
• Summary: This gene encodes a phosphoprotein, which is located in the outer and inner segments of the rod cells in the retina. This protein may participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. It modulates

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2291826	hsa-miR-3618	CLIP-seq
MIRT2291827	hsa-miR-934	CLIP-seq
MIRT2291826	hsa-miR-3618	CLIP-seq
MIRT2392242	hsa-miR-656	CLIP-seq
MIRT2291827	hsa-miR-934	CLIP-seq
MIRT2291826	hsa-miR-3618	CLIP-seq
MIRT2392242	hsa-miR-656	CLIP-seq
MIRT2291827	hsa-miR-934	CLIP-seq
MIRT2291826	hsa-miR-3618	CLIP-seq
MIRT2392242	hsa-miR-656	CLIP-seq
MIRT2291827	hsa-miR-934	CLIP-seq
MIRT2291826	hsa-miR-3618	CLIP-seq
MIRT2392242	hsa-miR-656	CLIP-seq
MIRT2291827	hsa-miR-934	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001750	Component	Photoreceptor outer segment	IBA
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0004859	Function	Phospholipase inhibitor activity	TAS	7961975
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005929	Component	Cilium	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	7961975
GO:0007601	Process	Visual perception	IEA
GO:0007602	Process	Phototransduction	TAS	8288249
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0042995	Component	Cell projection	IEA

Other IDs

• MIM: 171490
• HGNC: 8759
• e!Ensembl: ENSG00000116703

Protein

• UniProt ID: P20941
• Protein name: Phosducin (PHD) (33 kDa phototransducing protein) (Protein MEKA)
• Protein function: May participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. Inhibits the transcriptional activation activity of the cone-rod homeobox CRX.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02114	Phosducin	1 → 246	Phosducin	Domain

• Sequence:

  MEEAKSQSLEEDFEGQATHTGPKGVINDWRKFKLESQDSDSIPPSKKEILRQMSSPQSRN
  GKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETG
  KQFLETIEKELKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDR
  FSLDVLPTLLIYKGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREVHVLEHTKI
  EEEDVE

• Sequence length: 246

Related Genes

No strongly related genes found yet for PDC.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PDC.