PCP2 (Purkinje cell protein 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 126006
Gene name Purkinje cell protein 2
Gene symbol PCP2
Synonyms (NCBI Gene)
GPSM4PCD5
Chromosome 19
Chromosome location 19p13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005085 Function Guanyl-nucleotide exchange factor activity IBA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005515 Function Protein binding IPI 28514442, 32296183
GO:0016056 Process G protein-coupled opsin signaling pathway IEA
GO:0030695 Function GTPase regulator activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619344 30209 ENSG00000174788
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IVA1
Protein name Purkinje cell protein 2 homolog
Protein function May function as a cell-type specific modulator for G protein-mediated cell signaling.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02188 GoLoco 64 → 84 GoLoco motif Motif
PF02188 GoLoco 24 → 45 GoLoco motif Motif
Sequence 
MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPT
PEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTA
LGFRRNSSPQPPTQAP
Sequence length 136
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
G alpha (i) signalling events

No strongly related genes found yet for PCP2.

No additional diseases found yet through genes similar to PCP2.