Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	56106
Gene name	Protocadherin gamma subfamily A, 10
Gene symbol	PCDHGA10
Synonyms (NCBI Gene)	PCDH-GAMMA-A10
Chromosome	5
Chromosome location	5q31.3
Summary	This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regul

miRTarBase ID	miRNA	Experiments	Reference
MIRT017681	hsa-miR-335-5p	Microarray	18185580
MIRT021580	hsa-miR-142-3p	Microarray	17612493

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0005509	Function	Calcium ion binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0016020	Component	Membrane	IEA
GO:0050839	Function	Cell adhesion molecule binding	IBA

MIM	HGNC	e!Ensembl
606297	8697	ENSG00000253846

Q9Y5H3

Protein name

Protocadherin gamma-A10 (PCDH-gamma-A10)

Protein function

Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	251 → 342	Cadherin domain	Domain
PF00028	Cadherin	582 → 669	Cadherin domain	Domain
PF00028	Cadherin	358 → 447	Cadherin domain	Domain
PF00028	Cadherin	461 → 557	Cadherin domain	Domain
PF00028	Cadherin	142 → 237	Cadherin domain	Domain
PF08266	Cadherin_2	34 → 116	Cadherin-like	Domain
PF15974	Cadherin_tail	814 → 936	Cadherin C-terminal cytoplasmic tail, catenin-binding region	Family
PF16492	Cadherin_C_2	692 → 776	Cadherin cytoplasmic C-terminal	Family

Sequence

MAAQRNRSKESKDCSGLVLLCLFFGIPWEAGARQISYSIPEELEKGSFVGNISKDLGLAP
RELAERGVRIVSRGRTQLFSLNPRSGSLITAGRIDREELCAQSARCVVSFNILVEDRVKL
FGIEIEVTDINDNAPKFQAENLDVKINENVAAGMRFPLPEAIDPDVGVNSLQSYQLSPNK
HFSLRVQSRANGVKYPELVLEHSLDREEEAIHHLVLTASDGGDPLRSGTVLVSVTVFDAN
DNAPVFTLPEYRVSVPENLPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNK
YTGEIKISENLDYEETGFYEIEIQAEDGGAYLATAKVLITVEDVNDNSPELTITSLFSPV
TEDSPLGTVVALLNVHDLDSEQNGQVTCSILAYLPFKLEKSIDSYYRLVIHRALDREQVS
SYNITVTATDGGSPPLSTEAHFMLQVADINDNPPTFSQVSYFTYIPENNARGASIFSVTA
LDPDSKENAQIIYSLAEDTIQGVPLSSYISINSDTGVLYALRSFDYEQFHELQMQVTASD
SGDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDR
DSGQNAWLSYRLLKASEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSA
TVTLTVAVADSIPQVLADLGSFESPANSETSDLTLYLVVAVAAVSCVFLAFVIVLLAHRL
RRWHKSRLLQASGGGLTGVSGSHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIFPQPNYA
DTLISQESCEKNDPLSLLDDSKFPIEDTPLVPQAPPNTDWRFSQAQRPGTSGSQNGDDTG
TWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVY
IPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK

Sequence length

936

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
NEURODEVELOPMENTAL DISORDER WITH POOR GROWTH AND SKELETAL ANOMALIES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	39753749	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Glioblastoma	Glioblastoma	Pubtator	39208202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28940097		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with PCDHGA10 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PCDHGA10.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PCDHGA10 (see Related Genes above), that are NOT already directly curated for PCDHGA10 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PCDHGA10.

PCDHGA10 (protocadherin gamma subfamily A, 10)

Bookmark This Gene