PCDH10 (protocadherin 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57575
• Gene name: Protocadherin 10
• Gene symbol: PCDH10
• Synonyms (NCBI Gene): OL-PCDH, PCDH19
• Chromosome: 4
• Chromosome location: 4q28.3
• Summary: This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. This family member contains 6 extracellular cadherin domains, a transmembrane domain and a cytoplasmic tail differing from those of the classical cadherins. The e

miRNA Show/Hide all (216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045051	hsa-miR-186-5p	CLASH	23622248
MIRT519003	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT552018	hsa-miR-3924	HITS-CLIP	21572407
MIRT519000	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT519004	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT519003	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT552018	hsa-miR-3924	HITS-CLIP	21572407
MIRT519000	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT519003	hsa-miR-223-5p	HITS-CLIP	23313552
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT519000	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT519004	hsa-miR-5011-5p	HITS-CLIP	23706177
MIRT519003	hsa-miR-223-5p	HITS-CLIP	23706177
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	23706177
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	23706177
MIRT552018	hsa-miR-3924	HITS-CLIP	23706177
MIRT519000	hsa-miR-574-5p	HITS-CLIP	23706177
MIRT519004	hsa-miR-5011-5p	HITS-CLIP	23706177
MIRT519003	hsa-miR-223-5p	HITS-CLIP	23706177
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	23706177
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	23706177
MIRT552018	hsa-miR-3924	HITS-CLIP	23706177
MIRT519000	hsa-miR-574-5p	HITS-CLIP	23706177
MIRT519004	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT519003	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT519002	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT519001	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT552018	hsa-miR-3924	PAR-CLIP	21572407
MIRT519000	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT519004	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT519003	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT519002	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT519001	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT519000	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT442496	hsa-miR-561-3p	PAR-CLIP	22291592
MIRT442495	hsa-miR-365a-3p	PAR-CLIP	22291592
MIRT442494	hsa-miR-365b-3p	PAR-CLIP	22291592
MIRT442493	hsa-miR-7852-3p	PAR-CLIP	22291592
MIRT442496	hsa-miR-561-3p	PAR-CLIP	22100165
MIRT442495	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442494	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442493	hsa-miR-7852-3p	PAR-CLIP	22100165
MIRT442496	hsa-miR-561-3p	PAR-CLIP	22100165
MIRT442495	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442494	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442493	hsa-miR-7852-3p	PAR-CLIP	22100165
MIRT727000	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726999	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT726998	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT726997	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT726995	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT726996	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT726994	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	27418678
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	27418678
MIRT519003	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT519003	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT552018	hsa-miR-3924	HITS-CLIP	27418678
MIRT519004	hsa-miR-5011-5p	HITS-CLIP	27418678
MIRT519004	hsa-miR-5011-5p	HITS-CLIP	27418678
MIRT519000	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT519000	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT734494	hsa-miR-552-3p	ChIP-seq, Immunohistochemistry (IHC), In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	33867818
MIRT519003	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT552018	hsa-miR-3924	HITS-CLIP	21572407
MIRT519000	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT519004	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT519003	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT552018	hsa-miR-3924	HITS-CLIP	21572407
MIRT519000	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT519003	hsa-miR-223-5p	HITS-CLIP	23313552
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT519000	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT519004	hsa-miR-5011-5p	HITS-CLIP	23706177
MIRT519003	hsa-miR-223-5p	HITS-CLIP	23706177
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	23706177
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	23706177
MIRT552018	hsa-miR-3924	HITS-CLIP	23706177
MIRT519000	hsa-miR-574-5p	HITS-CLIP	23706177
MIRT519004	hsa-miR-5011-5p	HITS-CLIP	23706177
MIRT519003	hsa-miR-223-5p	HITS-CLIP	23706177
MIRT519002	hsa-miR-6867-5p	HITS-CLIP	23706177
MIRT519001	hsa-miR-190a-3p	HITS-CLIP	23706177
MIRT552018	hsa-miR-3924	HITS-CLIP	23706177
MIRT519000	hsa-miR-574-5p	HITS-CLIP	23706177
MIRT519004	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT519003	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT519002	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT519001	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT552018	hsa-miR-3924	PAR-CLIP	21572407
MIRT519000	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT519004	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT519003	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT519002	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT519001	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT519000	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT442496	hsa-miR-561-3p	PAR-CLIP	22291592
MIRT442495	hsa-miR-365a-3p	PAR-CLIP	22291592
MIRT442494	hsa-miR-365b-3p	PAR-CLIP	22291592
MIRT442493	hsa-miR-7852-3p	PAR-CLIP	22291592
MIRT442496	hsa-miR-561-3p	PAR-CLIP	22100165
MIRT442495	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442494	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442493	hsa-miR-7852-3p	PAR-CLIP	22100165
MIRT442496	hsa-miR-561-3p	PAR-CLIP	22100165
MIRT442495	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442494	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442493	hsa-miR-7852-3p	PAR-CLIP	22100165
MIRT1216561	hsa-miR-125a-3p	CLIP-seq
MIRT1216562	hsa-miR-1269	CLIP-seq
MIRT1216563	hsa-miR-1269b	CLIP-seq
MIRT1216564	hsa-miR-1288	CLIP-seq
MIRT1216565	hsa-miR-193a-5p	CLIP-seq
MIRT1216566	hsa-miR-19a	CLIP-seq
MIRT1216567	hsa-miR-19b	CLIP-seq
MIRT1216568	hsa-miR-200b	CLIP-seq
MIRT1216569	hsa-miR-200c	CLIP-seq
MIRT1216570	hsa-miR-2113	CLIP-seq
MIRT1216571	hsa-miR-25	CLIP-seq
MIRT1216572	hsa-miR-3065-5p	CLIP-seq
MIRT1216573	hsa-miR-30a	CLIP-seq
MIRT1216574	hsa-miR-30b	CLIP-seq
MIRT1216575	hsa-miR-30c	CLIP-seq
MIRT1216576	hsa-miR-30d	CLIP-seq
MIRT1216577	hsa-miR-30e	CLIP-seq
MIRT1216578	hsa-miR-3130-5p	CLIP-seq
MIRT1216579	hsa-miR-3138	CLIP-seq
MIRT1216580	hsa-miR-3145-3p	CLIP-seq
MIRT1216581	hsa-miR-32	CLIP-seq
MIRT1216582	hsa-miR-324-5p	CLIP-seq
MIRT1216583	hsa-miR-33a	CLIP-seq
MIRT1216584	hsa-miR-33b	CLIP-seq
MIRT1216585	hsa-miR-3607-3p	CLIP-seq
MIRT1216586	hsa-miR-363	CLIP-seq
MIRT1216587	hsa-miR-367	CLIP-seq
MIRT1216588	hsa-miR-3689a-5p	CLIP-seq
MIRT1216589	hsa-miR-3689b	CLIP-seq
MIRT1216590	hsa-miR-3689e	CLIP-seq
MIRT1216591	hsa-miR-3689f	CLIP-seq
MIRT1216592	hsa-miR-374a	CLIP-seq
MIRT1216593	hsa-miR-374b	CLIP-seq
MIRT1216594	hsa-miR-4263	CLIP-seq
MIRT1216595	hsa-miR-4265	CLIP-seq
MIRT1216596	hsa-miR-4269	CLIP-seq
MIRT1216597	hsa-miR-4275	CLIP-seq
MIRT1216598	hsa-miR-429	CLIP-seq
MIRT1216599	hsa-miR-4296	CLIP-seq
MIRT1216600	hsa-miR-4322	CLIP-seq
MIRT1216601	hsa-miR-4328	CLIP-seq
MIRT1216602	hsa-miR-4482	CLIP-seq
MIRT1216603	hsa-miR-450b-5p	CLIP-seq
MIRT1216604	hsa-miR-4515	CLIP-seq
MIRT1216605	hsa-miR-4718	CLIP-seq
MIRT1216606	hsa-miR-4719	CLIP-seq
MIRT1216607	hsa-miR-4724-5p	CLIP-seq
MIRT1216608	hsa-miR-4729	CLIP-seq
MIRT1216609	hsa-miR-4740-5p	CLIP-seq
MIRT1216610	hsa-miR-4800-5p	CLIP-seq
MIRT1216611	hsa-miR-4802-3p	CLIP-seq
MIRT1216612	hsa-miR-494	CLIP-seq
MIRT1216613	hsa-miR-511	CLIP-seq
MIRT1216614	hsa-miR-513a-3p	CLIP-seq
MIRT1216615	hsa-miR-548ac	CLIP-seq
MIRT1216616	hsa-miR-548ae	CLIP-seq
MIRT1216617	hsa-miR-548aj	CLIP-seq
MIRT1216618	hsa-miR-548am	CLIP-seq
MIRT1216619	hsa-miR-548d-3p	CLIP-seq
MIRT1216620	hsa-miR-548x	CLIP-seq
MIRT1216621	hsa-miR-548z	CLIP-seq
MIRT1216622	hsa-miR-552	CLIP-seq
MIRT1216623	hsa-miR-568	CLIP-seq
MIRT1216624	hsa-miR-576-5p	CLIP-seq
MIRT1216625	hsa-miR-586	CLIP-seq
MIRT1216626	hsa-miR-603	CLIP-seq
MIRT1216627	hsa-miR-892b	CLIP-seq
MIRT1216628	hsa-miR-92a	CLIP-seq
MIRT1216629	hsa-miR-92b	CLIP-seq
MIRT1216614	hsa-miR-513a-3p	CLIP-seq
MIRT2062543	hsa-miR-101	CLIP-seq
MIRT2062544	hsa-miR-132	CLIP-seq
MIRT2062545	hsa-miR-144	CLIP-seq
MIRT1216566	hsa-miR-19a	CLIP-seq
MIRT1216567	hsa-miR-19b	CLIP-seq
MIRT2062546	hsa-miR-203	CLIP-seq
MIRT1216570	hsa-miR-2113	CLIP-seq
MIRT2062547	hsa-miR-212	CLIP-seq
MIRT2062548	hsa-miR-224	CLIP-seq
MIRT1216573	hsa-miR-30a	CLIP-seq
MIRT1216574	hsa-miR-30b	CLIP-seq
MIRT1216575	hsa-miR-30c	CLIP-seq
MIRT1216576	hsa-miR-30d	CLIP-seq
MIRT1216577	hsa-miR-30e	CLIP-seq
MIRT1216580	hsa-miR-3145-3p	CLIP-seq
MIRT2062549	hsa-miR-3163	CLIP-seq
MIRT2062550	hsa-miR-3612	CLIP-seq
MIRT2062551	hsa-miR-377	CLIP-seq
MIRT2062552	hsa-miR-3977	CLIP-seq
MIRT1216603	hsa-miR-450b-5p	CLIP-seq
MIRT1216606	hsa-miR-4719	CLIP-seq
MIRT1216613	hsa-miR-511	CLIP-seq
MIRT2062553	hsa-miR-542-5p	CLIP-seq
MIRT1216623	hsa-miR-568	CLIP-seq
MIRT1216626	hsa-miR-603	CLIP-seq
MIRT2062554	hsa-miR-650	CLIP-seq
MIRT2455987	hsa-miR-141	CLIP-seq
MIRT2455988	hsa-miR-200a	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0016020	Component	Membrane	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 608286
• HGNC: 13404
• e!Ensembl: ENSG00000138650

Protein

• UniProt ID: Q9P2E7
• Protein name: Protocadherin-10
• Protein function: Potential calcium-dependent cell-adhesion protein.; (Microbial infection) Acts as a receptor for Western equine encephalitis virus.
• PDB: 6VFQ , 6VFW , 6VG4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00028	Cadherin	255 → 349	Cadherin domain	Domain
  PF00028	Cadherin	589 → 679	Cadherin domain	Domain
  PF00028	Cadherin	364 → 454	Cadherin domain	Domain
  PF00028	Cadherin	468 → 565	Cadherin domain	Domain
  PF00028	Cadherin	127 → 241	Cadherin domain	Domain
  PF08266	Cadherin_2	19 → 101	Cadherin-like	Domain
  PF16492	Cadherin_C_2	713 → 838	Cadherin cytoplasmic C-terminal	Family

• Tissue specificity: TISSUE SPECIFICITY: Moderately expressed in all regions of the brain examined, as well as in testis and ovary, and low expression in all other tissues tested. {ECO:0000269|PubMed:11549318}.
• Sequence:

  MIVLLLFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSR
  TPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPP
  SFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRF
  AELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRV
  LDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRAREL
  FGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISF
  STVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAP
  LDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGA
  YIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFS
  FQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLL
  TRVAAVDADDGENARLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYELVIEV
  RDHGQPPLSSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQRPSRSGGGETSLDLTLILII
  ALGSVSFIFLLAMIVLAVRCQKEKKLNIYTCLASDCCLCCCCCGGGGSTCCGRQARARKK
  KLSKSDIMLVQSSNVPSNPAQVPIEESGGFGSHHHNQNYCYQVCLTPESAKTDLMFLKPC
  SPSRSTDTEHNPCGAIVTGYTDQQPDIISNGSILSNETKHQRAELSYLVDRPRRVNSSAF
  QEADIVSSKDSGHGDSEQGDSDHDATNRAQSAGMDLFSNCTEECKALGHSDRCWMPSFVP
  SDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDG
  LLTNTRAPYKPPYLTRKRIC

• Sequence length: 1040

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	18621663	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	34067580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	34343768	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	31545351	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (185)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21960365		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21960365		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	29202805		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21597995		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31651684		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31088413		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	31205075	Associate	★☆☆☆☆ Found in Text Mining only
Atypical absence seizure	Absence Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	29377098, 32366910, 32722525, 36980870	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19752159, 23334464, 27179713, 27567313, 28844789		★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	LHGDN	16261168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18621663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	21480887, 22946748, 28334947, 29377098, 30653859, 32314541, 33399642, 36980870, 38238304, 39457436	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	22765916, 26123493, 27567313, 31747920		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Awakening Epilepsy	Epilepsy	CTD_human_DG	18469813		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23929756		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23321168		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	19214208, 21480887, 25818041, 29190809, 29866057, 33087045, 38238304, 39457436	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30214581		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33899544	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	17341268	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19709077	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16247458, 17341268, 22543497, 25260683		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28498423	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30170418	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	19709077	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23321168		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23321465		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31088413	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26970279		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	38003275	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19681120, 19709077		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19681120		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21960365		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21597995		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	29377098	Associate	★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21480887, 21777234, 26765483, 28334947, 29064093, 33010346, 33399642	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27179713		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23180019, 23839493, 24740680, 28454418		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	23180019		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23839493, 24309322, 34841662	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizure with impairment of consciousness	Dyscognitive seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	26993267, 30653859, 39187419, 39457436	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38003275	Stimulate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29202805		★☆☆☆☆ Found in Text Mining only
Dravet syndrome	Dravet Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	18234694, 18469813, 19214208, 19752159, 20713952, 21053371, 21463275, 21480887, 21519002, 22050978, 22267240, 22946748, 26765483, 27016041, 28462982, 28669061		★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	25085246, 26970279		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	19214208, 21480887, 26271793, 31185419		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25085246		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29693365	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36239569	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	19214208, 21053371, 25218114, 26820223, 39187419	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	27029629, 37390664	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	18469813, 19214208, 19752159, 20713952, 20830798, 21053371, 21480887, 21519002, 21777234, 22050978, 22091964, 22267240, 22504056, 22633638, 22765916, 22946725, 22946748, 22949144, 23066759, 23712037, 25204757, 25218114, 25225143, 25499160, 25510386, 25891919, 26123493, 26765483, 26820223, 26898795, 27177984, 27179713, 27240640, 27371789, 27527380, 27787195, 28334947, 28471529, 28724954, 29064093, 29301106, 29360992, 29377098, 29763708, 29866057, 29933145, 30431232, 30451291, 30530412, 30572518, 30828795, 31185419, 31714027, 31747920		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	LHGDN	18469813		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	18469813		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CLINGEN_DG	19214208, 21480887		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	21053371, 21480887, 21777234, 25218114, 26765483, 26802095, 26820223, 28334947, 28669061, 28837158, 29056246, 29064093, 29190809, 29377098, 29866057, 30185235, 30287595, 30572518, 30653859, 30977854, 31714027, 32314541, 32366910, 32613771, 32682289, 33010346, 33087045, 33262389, 33399642, 34520737, 35441233, 35613587, 35978409, 36870093, 36980870, 37095367, 37956604, 39187419	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Absence	Absence epilepsy	Pubtator	19214208	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Benign Neonatal	Benign neonatal epilepsy	Pubtator	29064093	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	18469813		★☆☆☆☆ Found in Text Mining only
EPILEPSY, FEMALE-RESTRICTED, WITH MENTAL RETARDATION (disorder)	Epileptic Encephalopathy And Intellectual Disability	UNIPROT_DG	18469813, 19214208, 19752159, 20713952, 20830798, 21053371, 21480887, 21519002, 22050978, 22267240, 25818041, 26993267		★☆☆☆☆ Found in Text Mining only
EPILEPSY, FEMALE-RESTRICTED, WITH MENTAL RETARDATION (disorder)	Epileptic Encephalopathy And Intellectual Disability	ORPHANET_DG	18469813, 19752159, 20830798		★☆☆☆☆ Found in Text Mining only
EPILEPSY, FEMALE-RESTRICTED, WITH MENTAL RETARDATION (disorder)	Epileptic Encephalopathy And Intellectual Disability	CLINVAR_DG	18469813, 19214208, 20713952, 21053371, 21480887, 22267240, 2267240, 22848613, 22946748, 23334464, 23808377, 26765483, 27143072, 27527380		★☆☆☆☆ Found in Text Mining only
EPILEPSY, FEMALE-RESTRICTED, WITH MENTAL RETARDATION (disorder)	Epileptic Encephalopathy And Intellectual Disability	GENOMICS_ENGLAND_DG	19752159, 28462982		★☆☆☆☆ Found in Text Mining only
EPILEPSY, FEMALE-RESTRICTED, WITH MENTAL RETARDATION (disorder)	Epileptic Encephalopathy And Intellectual Disability	BEFREE	22091964, 22949144		★☆☆☆☆ Found in Text Mining only
EPILEPSY, FEMALE-RESTRICTED, WITH MENTAL RETARDATION (disorder)	Epileptic Encephalopathy And Intellectual Disability	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Epilepsy, Rolandic	Epilepsy	CLINVAR_DG	29358611		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	BEFREE	22267240, 27016041, 29763708		★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	33557955, 37482918, 37867425, 38238304	Associate	★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	19214208, 21463275, 21504425, 22050978, 22848613, 25204757, 25225143, 25510386, 27371789, 27527380, 29341473		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20353276		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	25218114		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Female restricted epilepsy with intellectual disability	Female Restricted Epilepsy With Intellectual Disability	Orphanet			★☆☆☆☆ Found in Text Mining only
Focal Clonic Seizures	Focal Clonic Seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	35441233	Associate	★☆☆☆☆ Found in Text Mining only
Focal seizures, afebril	Focal Seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30213786		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	27659532		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	27659532	Associate	★☆☆☆☆ Found in Text Mining only
Generalized clonic seizures	Clonic Seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Generalized Epilepsy With Febrile Seizures Plus Type 1	Generalized epilepsy with febrile seizures plus	Pubtator	21053371	Associate	★☆☆☆☆ Found in Text Mining only
Generalized myoclonic seizures	Myoclonic Seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	26765483, 29866057		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Generalized tonic-clonic seizures with focal onset	Bilateral convulsive seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24406169		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24406169		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30507090		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	19752159, 29933145		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23180019		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	17341268	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	38003275	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	38238304	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	18469813, 22267240, 22765916, 26765483, 27179713		★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	19214208, 21463275, 21504425, 22050978, 22848613, 25204757, 25225143, 25510386, 27371789, 27527380, 29341473		★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	ORPHANET_DG	19214208, 21463275, 22848613, 23093055, 23808377		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	18469813, 19752159, 20713952, 20830798, 21053371, 21519002, 22091964, 22267240, 22633638, 22946748, 22949144, 23334464, 25218114, 25510386, 26123493, 26820223, 26898795, 27177984, 27179713, 28669061, 28724954, 29866057, 29933145, 30451291, 30530412, 30572518, 31678000, 31714027		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	21053371, 22946748, 25218114, 26820223, 28669061, 29866057, 30572518, 30653859, 31714027, 32314541, 33087045, 33262389, 33399642, 35715422, 36980870, 38238304, 39187419	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30214581		★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	19214208	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21960365		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22543497, 28422868, 28498423, 29749051, 30170418		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23321465	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25086586, 30170418	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37147733	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	17341268, 31210316	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23929756		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	29064093	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30214581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23321465		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20353276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21314642, 25086586		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19084528, 20353276, 22206871, 25260683, 26406945		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23321168		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17341268, 20353276, 22206871, 23171734, 23929756, 24740680, 24888369, 25590240, 27176920, 29749051		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19681120		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21597995		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	18469813, 19752159, 20713952, 20830798, 21053371, 21519002, 22091964, 22267240, 22633638, 22946748, 22949144, 23334464, 25218114, 25510386, 26820223, 26898795, 27177984, 28724954, 29866057, 29933145, 30530412, 30572518, 31714027		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	CTD_human_DG	18469813		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	32314541	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22245948, 24888369, 26081897		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	22245948	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16247458, 20353276		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16247458, 19084528, 19681120, 20353276, 20833385, 21187191, 21314642, 21597995, 21960365, 22206871, 22543497, 23171734, 23180019, 23321465, 23839493, 24406169, 24740680, 24888369, 25085246, 25086586, 25260683, 25590240, 26081897, 26970279, 27176920, 29202805, 30170418, 30214581		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	29866057	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28837158	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28837158		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23321465		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30828795		★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obtundation status	Obtundation status	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31088413		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26683936, 33867818	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	27179713		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21960365		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21314642, 25086586		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25086586	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30828795		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	31714027, 39950246	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	19752159		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22765916, 30828795		★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Complex	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	19214208, 21053371, 21480887, 22932693, 26765483, 26820223, 28669061, 29064093, 29377098, 29866057, 30572518, 32314541, 32366910, 32682289, 33087045, 33262389, 33399642, 33557955, 35715422, 35978409, 36870093, 37956604, 38238304, 39187419	Associate	★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	33399642	Associate	★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spasms Infantile	Infantile spasms	Pubtator	35715422	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31678000		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status epilepticus	Pubtator	33399642, 35914944	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19084528, 20353276, 22206871, 25260683, 26406945		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	26269563	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	19084528		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24128875, 26871474, 33527791	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37147733	Inhibit	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	23929756		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	23171734		★☆☆☆☆ Found in Text Mining only
Temporal cortical atrophy	Temporal cortical atrophy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	23171734		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23321168, 35958598	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23569128	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	20833385		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19681120, 19709077, 28351298	Associate	★☆☆☆☆ Found in Text Mining only
X-linked infantile spasms	Spasms X-Linked	BEFREE	25204757, 27016041, 28462982, 29866057, 30431232		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PCDH10.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PCDH10.