PCBP4 (poly(rC) binding protein 4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 57060
Gene name Poly(rC) binding protein 4
Gene symbol PCBP4
Synonyms (NCBI Gene)
CBPLIP4MCG10
Chromosome 3
Chromosome location 3p21.2
Summary This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1216555 hsa-miR-3613-3p CLIP-seq
MIRT1216556 hsa-miR-4251 CLIP-seq
MIRT1216557 hsa-miR-4272 CLIP-seq
MIRT1216558 hsa-miR-580 CLIP-seq
MIRT2392185 hsa-miR-671-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19 Show/Hide all (19)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22658674
GO:0003723 Function RNA binding IEA
GO:0003723 Function RNA binding NAS 10936052
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608503 8652 ENSG00000090097
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57723
Protein name Poly(rC)-binding protein 4 (Alpha-CP4)
Protein function Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00013 KH_1 243 → 307 KH domain Domain
PF00013 KH_1 103 → 168 KH domain Domain
PF00013 KH_1 19 → 80 KH domain Domain
Sequence 
MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPE
RITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKA
GTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATI
PYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQ
TSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIAL
AQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPYAISLSNFIGL
KPMPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY
Sequence length 403
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
Transcriptional activation of cell cycle inhibitor p21
FOXO-mediated transcription of cell cycle genes
Sort by:
ZNF385A 2 shared pathwaysTP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest, Transcriptional activation of cell cycle inhibitor p21 Related via 2 shared pathways including TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest, Transcriptional activation of cell cycle inhibitor p21 . CDKN1A 3 shared pathwaysTP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest, Transcriptional activation of cell cycle inhibitor p21 , FOXO-mediated transcription of cell cycle genes Related via 3 shared pathways including TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest, Transcriptional activation of cell cycle inhibitor p21 . TP53 2 shared pathwaysTP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest, Transcriptional activation of cell cycle inhibitor p21 Related via 2 shared pathways including TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest, Transcriptional activation of cell cycle inhibitor p21 .
Breast cancer Linked via 2 of 3 related genesCDKN1A, TP53 Transitional cell carcinoma Linked via 2 of 3 related genesCDKN1A, TP53 Cardiomyopathy Linked via 2 of 3 related genesCDKN1A, TP53 Obstructive airway disease Linked via 2 of 3 related genesCDKN1A, TP53 Colonic neoplasms Linked via 2 of 3 related genesCDKN1A, TP53