PCBP3 (poly(rC) binding protein 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54039
• Gene name: Poly(rC) binding protein 3
• Gene symbol: PCBP3
• Synonyms (NCBI Gene): ALPHA-CP3, PCBP3-OT1, PCBP3OT
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h

miRNA Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018087	hsa-miR-335-5p	Microarray	18185580
MIRT029600	hsa-miR-26b-5p	Microarray	19088304
MIRT1216541	hsa-miR-338-5p	CLIP-seq
MIRT1216542	hsa-miR-4263	CLIP-seq
MIRT1216543	hsa-miR-4799-5p	CLIP-seq
MIRT1216544	hsa-miR-576-5p	CLIP-seq
MIRT1216545	hsa-miR-1207-5p	CLIP-seq
MIRT1216546	hsa-miR-1262	CLIP-seq
MIRT1216547	hsa-miR-3128	CLIP-seq
MIRT1216548	hsa-miR-3665	CLIP-seq
MIRT1216549	hsa-miR-4701-3p	CLIP-seq
MIRT1216550	hsa-miR-4720-5p	CLIP-seq
MIRT1216551	hsa-miR-4736	CLIP-seq
MIRT1216552	hsa-miR-4763-3p	CLIP-seq
MIRT1216553	hsa-miR-4799-3p	CLIP-seq
MIRT1216554	hsa-miR-760	CLIP-seq
MIRT2465807	hsa-miR-4797-5p	CLIP-seq
MIRT2465808	hsa-miR-759	CLIP-seq
MIRT2588571	hsa-miR-217	CLIP-seq
MIRT2588572	hsa-miR-224	CLIP-seq
MIRT1216541	hsa-miR-338-5p	CLIP-seq
MIRT1216542	hsa-miR-4263	CLIP-seq
MIRT1216543	hsa-miR-4799-5p	CLIP-seq
MIRT2588573	hsa-miR-483-5p	CLIP-seq
MIRT1216544	hsa-miR-576-5p	CLIP-seq
MIRT1216541	hsa-miR-338-5p	CLIP-seq
MIRT1216542	hsa-miR-4263	CLIP-seq
MIRT1216543	hsa-miR-4799-5p	CLIP-seq
MIRT1216544	hsa-miR-576-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	NAS	10936052
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	HDA	16780588
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	HDA	16780588
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0016071	Process	MRNA metabolic process	NAS
GO:0039694	Process	Viral RNA genome replication	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1990829	Function	C-rich single-stranded DNA binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 608502
• HGNC: 8651
• e!Ensembl: ENSG00000183570

Protein

• UniProt ID: P57721
• Protein name: Poly(rC)-binding protein 3 (Alpha-CP3) (PCBP3-overlapping transcript) (PCBP3-overlapping transcript 1)
• Protein function: Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00013	KH_1	131 → 195	KH domain	Domain
  PF00013	KH_1	295 → 359	KH domain	Domain
  PF00013	KH_1	47 → 109	KH domain	Domain

• Sequence:

  MGEGDAFWAPSVLPHSTLSTLSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSI
  IGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMS
  NSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTI
  SGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQ
  LTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
  PNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINAR
  LTSEVTGMGTL

• Sequence length: 371

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (13)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PCBP3-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30275197		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30275197		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35920801	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30694715	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	40016701	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PCBP3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PCBP3.