PATZ1 (POZ/BTB and AT hook containing zinc finger 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 23598
• Gene name: POZ/BTB and AT hook containing zinc finger 1
• Gene symbol: PATZ1
• Synonyms (NCBI Gene): MAZR, PATZ, RIAZ, ZBTB19, ZNF278, ZSG, dJ400N23
• Chromosome: 22
• Chromosome location: 22q12.2
• Summary: The protein encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for p

miRNA Show/Hide all (143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048585	hsa-miR-100-5p	CLASH	23622248
MIRT532689	hsa-miR-3680-5p	PAR-CLIP	22012620
MIRT532688	hsa-miR-4636	PAR-CLIP	22012620
MIRT532687	hsa-miR-518c-5p	PAR-CLIP	22012620
MIRT532686	hsa-miR-326	PAR-CLIP	22012620
MIRT532685	hsa-miR-330-5p	PAR-CLIP	22012620
MIRT532684	hsa-miR-6764-3p	PAR-CLIP	22012620
MIRT532683	hsa-miR-6824-3p	PAR-CLIP	22012620
MIRT157749	hsa-miR-942-5p	PAR-CLIP	22012620
MIRT532682	hsa-miR-6089	PAR-CLIP	22012620
MIRT532681	hsa-miR-3612	PAR-CLIP	22012620
MIRT532680	hsa-miR-650	PAR-CLIP	22012620
MIRT532679	hsa-miR-504-3p	PAR-CLIP	22012620
MIRT532678	hsa-miR-122-5p	PAR-CLIP	22012620
MIRT532677	hsa-miR-3191-5p	PAR-CLIP	22012620
MIRT532676	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT532675	hsa-miR-4443	PAR-CLIP	22012620
MIRT532674	hsa-miR-7114-5p	PAR-CLIP	22012620
MIRT440038	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT440038	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT532689	hsa-miR-3680-5p	PAR-CLIP	22012620
MIRT532688	hsa-miR-4636	PAR-CLIP	22012620
MIRT532687	hsa-miR-518c-5p	PAR-CLIP	22012620
MIRT532686	hsa-miR-326	PAR-CLIP	22012620
MIRT532685	hsa-miR-330-5p	PAR-CLIP	22012620
MIRT532684	hsa-miR-6764-3p	PAR-CLIP	22012620
MIRT532683	hsa-miR-6824-3p	PAR-CLIP	22012620
MIRT157749	hsa-miR-942-5p	PAR-CLIP	22012620
MIRT532682	hsa-miR-6089	PAR-CLIP	22012620
MIRT532681	hsa-miR-3612	PAR-CLIP	22012620
MIRT532680	hsa-miR-650	PAR-CLIP	22012620
MIRT532679	hsa-miR-504-3p	PAR-CLIP	22012620
MIRT532678	hsa-miR-122-5p	PAR-CLIP	22012620
MIRT532677	hsa-miR-3191-5p	PAR-CLIP	22012620
MIRT532676	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT532675	hsa-miR-4443	PAR-CLIP	22012620
MIRT532674	hsa-miR-7114-5p	PAR-CLIP	22012620
MIRT1215160	hsa-miR-1256	CLIP-seq
MIRT1215161	hsa-miR-4282	CLIP-seq
MIRT1215162	hsa-miR-4463	CLIP-seq
MIRT1215163	hsa-miR-4494	CLIP-seq
MIRT1215164	hsa-miR-450b-5p	CLIP-seq
MIRT1215165	hsa-miR-4720-5p	CLIP-seq
MIRT1215166	hsa-miR-4799-3p	CLIP-seq
MIRT1215167	hsa-miR-507	CLIP-seq
MIRT1215168	hsa-miR-557	CLIP-seq
MIRT1215169	hsa-miR-29a	CLIP-seq
MIRT1215170	hsa-miR-29b	CLIP-seq
MIRT1215171	hsa-miR-29c	CLIP-seq
MIRT1215172	hsa-miR-3622a-3p	CLIP-seq
MIRT1215173	hsa-miR-3622b-3p	CLIP-seq
MIRT1215174	hsa-miR-3663-3p	CLIP-seq
MIRT1215175	hsa-miR-374c	CLIP-seq
MIRT1215176	hsa-miR-383	CLIP-seq
MIRT1215177	hsa-miR-4733-3p	CLIP-seq
MIRT1215178	hsa-miR-4742-3p	CLIP-seq
MIRT1215179	hsa-miR-4772-5p	CLIP-seq
MIRT1215180	hsa-miR-622	CLIP-seq
MIRT1215181	hsa-miR-655	CLIP-seq
MIRT1215182	hsa-miR-3153	CLIP-seq
MIRT1215183	hsa-miR-3936	CLIP-seq
MIRT1215184	hsa-miR-4435	CLIP-seq
MIRT1215185	hsa-miR-4651	CLIP-seq
MIRT1215186	hsa-miR-4755-3p	CLIP-seq
MIRT1215187	hsa-miR-608	CLIP-seq
MIRT1215188	hsa-miR-1224-3p	CLIP-seq
MIRT1215189	hsa-miR-1260	CLIP-seq
MIRT1215190	hsa-miR-1260b	CLIP-seq
MIRT1215191	hsa-miR-1275	CLIP-seq
MIRT1215192	hsa-miR-1280	CLIP-seq
MIRT1215193	hsa-miR-1343	CLIP-seq
MIRT1215194	hsa-miR-186	CLIP-seq
MIRT1215169	hsa-miR-29a	CLIP-seq
MIRT1215170	hsa-miR-29b	CLIP-seq
MIRT1215171	hsa-miR-29c	CLIP-seq
MIRT1215195	hsa-miR-3133	CLIP-seq
MIRT1215196	hsa-miR-3152-5p	CLIP-seq
MIRT1215197	hsa-miR-3170	CLIP-seq
MIRT1215198	hsa-miR-3199	CLIP-seq
MIRT1215174	hsa-miR-3663-3p	CLIP-seq
MIRT1215199	hsa-miR-3667-3p	CLIP-seq
MIRT1215200	hsa-miR-4267	CLIP-seq
MIRT1215201	hsa-miR-4312	CLIP-seq
MIRT1215202	hsa-miR-432	CLIP-seq
MIRT1215203	hsa-miR-4481	CLIP-seq
MIRT1215204	hsa-miR-4515	CLIP-seq
MIRT1215205	hsa-miR-4665-5p	CLIP-seq
MIRT1215177	hsa-miR-4733-3p	CLIP-seq
MIRT1215206	hsa-miR-4738-3p	CLIP-seq
MIRT1215207	hsa-miR-4745-5p	CLIP-seq
MIRT1215208	hsa-miR-4774-3p	CLIP-seq
MIRT1215209	hsa-miR-486-3p	CLIP-seq
MIRT1215210	hsa-miR-548c-3p	CLIP-seq
MIRT2061945	hsa-miR-1276	CLIP-seq
MIRT2061946	hsa-miR-23a	CLIP-seq
MIRT2061947	hsa-miR-23b	CLIP-seq
MIRT2061948	hsa-miR-23c	CLIP-seq
MIRT1215175	hsa-miR-374c	CLIP-seq
MIRT2061949	hsa-miR-499-3p	CLIP-seq
MIRT2061950	hsa-miR-499a-3p	CLIP-seq
MIRT1215181	hsa-miR-655	CLIP-seq
MIRT2061951	hsa-miR-1273g	CLIP-seq
MIRT2061952	hsa-miR-4310	CLIP-seq
MIRT2290404	hsa-miR-1233	CLIP-seq
MIRT2061945	hsa-miR-1276	CLIP-seq
MIRT2290405	hsa-miR-1281	CLIP-seq
MIRT2290406	hsa-miR-199a-3p	CLIP-seq
MIRT2290407	hsa-miR-199b-3p	CLIP-seq
MIRT2290408	hsa-miR-24	CLIP-seq
MIRT2290409	hsa-miR-3129-5p	CLIP-seq
MIRT1215197	hsa-miR-3170	CLIP-seq
MIRT1215172	hsa-miR-3622a-3p	CLIP-seq
MIRT1215173	hsa-miR-3622b-3p	CLIP-seq
MIRT1215175	hsa-miR-374c	CLIP-seq
MIRT2290410	hsa-miR-3908	CLIP-seq
MIRT2290411	hsa-miR-3942-5p	CLIP-seq
MIRT2290412	hsa-miR-4290	CLIP-seq
MIRT2290413	hsa-miR-4437	CLIP-seq
MIRT2290414	hsa-miR-4514	CLIP-seq
MIRT2290415	hsa-miR-4645-5p	CLIP-seq
MIRT2290416	hsa-miR-4673	CLIP-seq
MIRT2290417	hsa-miR-4687-5p	CLIP-seq
MIRT2290418	hsa-miR-4692	CLIP-seq
MIRT2290419	hsa-miR-4703-5p	CLIP-seq
MIRT1215178	hsa-miR-4742-3p	CLIP-seq
MIRT2290420	hsa-miR-4766-3p	CLIP-seq
MIRT2290421	hsa-miR-516b	CLIP-seq
MIRT2290422	hsa-miR-520d-5p	CLIP-seq
MIRT2290423	hsa-miR-524-5p	CLIP-seq
MIRT1215181	hsa-miR-655	CLIP-seq
MIRT2290424	hsa-miR-936	CLIP-seq
MIRT2588506	hsa-miR-4659a-3p	CLIP-seq
MIRT2588507	hsa-miR-4659b-3p	CLIP-seq
MIRT2588508	hsa-miR-548a-3p	CLIP-seq
MIRT2588509	hsa-miR-548e	CLIP-seq
MIRT2588510	hsa-miR-548f	CLIP-seq
MIRT2588511	hsa-miR-587	CLIP-seq
MIRT2588506	hsa-miR-4659a-3p	CLIP-seq
MIRT2588507	hsa-miR-4659b-3p	CLIP-seq
MIRT2588508	hsa-miR-548a-3p	CLIP-seq
MIRT2588509	hsa-miR-548e	CLIP-seq
MIRT2588510	hsa-miR-548f	CLIP-seq
MIRT2588511	hsa-miR-587	CLIP-seq

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	10949935
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	27107012, 32296183, 32814053, 36931259
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10713105
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	10713105
GO:0007283	Process	Spermatogenesis	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010596	Process	Negative regulation of endothelial cell migration	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	10713105
GO:0045892	Process	Negative regulation of DNA-templated transcription	TAS	10713105
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 605165
• HGNC: 13071
• e!Ensembl: ENSG00000100105

Protein

• UniProt ID: Q9HBE1
• Protein name: POZ-, AT hook-, and zinc finger-containing protein 1 (BTB/POZ domain zinc finger transcription factor) (Protein kinase A RI subunit alpha-associated protein) (Zinc finger and BTB domain-containing protein 19) (Zinc finger protein 278) (Zinc finger sarcoma
• Protein function: Transcriptional regulator that plays a role in many biological processes such as embryogenesis, senescence, T-cell development or neurogenesis (PubMed:10713105, PubMed:25755280, PubMed:31875552). Interacts with the TP53 protein to control genes
• PDB: 2EPP , 2EPQ , 2EPR , 2EPS , 2YT9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	605 → 628	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	413 → 436	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	356 → 377	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	383 → 405	Zinc finger, C2H2 type	Domain
  PF00651	BTB	30 → 160	BTB/POZ domain	Domain
  PF13894	zf-C2H2_4	496 → 518		Domain
  PF13912	zf-C2H2_6	442 → 467		Domain
  PF16637	zf-C2H2_assoc3	536 → 604		Disordered

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
  ACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDF
  AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
  SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAG
  PLSPQLLTSPFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
  FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
  GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
  GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
  YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGAAFH
  CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSANGSFSCDMAVPKNKMESD
  GEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFG
  FQIVQSAFASSLVDPEVDQQPMGPEGK

• Sequence length: 687

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Ependymoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (43)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplasia	Anaplasia	BEFREE	29137300		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25595894		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24819318		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24819318		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24819318	Associate	★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	33012788	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	31614588		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33378126, 34417833	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31099194, 34099871	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	33378126, 34099871, 34417833, 38007157	Associate	★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	31099194		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18401526		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18401526, 29039562		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18401526		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23296645		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	30379650		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	30379650	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29137300		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27494852		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	26810070		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28938636, 31614588		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33378126, 34417833	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28938636		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28912153, 29679497, 34417833	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31614588		★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	29679497, 32362012, 33459994, 35115049	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22493480		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	27494852		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25880836		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25595894, 29137300, 29584698		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20026299, 21596365, 22886576, 25595894, 28938636, 29186807, 31189996		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18401526		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18241078, 18401526, 22886576, 25595894, 27494852, 29137300, 29431183, 30379650, 31232935, 31614588		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29926841	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	10949935		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29679497, 30379650, 31189996, 31802230		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30379650, 31189996, 33012788, 34099871, 34417833, 38007157	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	29431183		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	21381029		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	18241078		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25595894, 29137300, 29584698		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25595894, 29137300, 29584698		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40711489	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PATZ1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PATZ1.