PATE3 (prostate and testis expressed 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 100169851
• Gene name: Prostate and testis expressed 3
• Gene symbol: PATE3
• Synonyms (NCBI Gene): HEL-127, PATE-DJ
• Chromosome: 11
• Chromosome location: 11q24.2

miRNA Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1215025	hsa-miR-3202	CLIP-seq
MIRT1215026	hsa-miR-4436a	CLIP-seq
MIRT1215027	hsa-miR-4462	CLIP-seq
MIRT2061901	hsa-miR-2110	CLIP-seq
MIRT2061902	hsa-miR-3144-5p	CLIP-seq
MIRT2061903	hsa-miR-3150a-3p	CLIP-seq
MIRT2061904	hsa-miR-3191	CLIP-seq
MIRT2061905	hsa-miR-4652-5p	CLIP-seq
MIRT2290284	hsa-miR-1257	CLIP-seq
MIRT2588482	hsa-miR-3132	CLIP-seq
MIRT2588483	hsa-miR-3160-5p	CLIP-seq
MIRT2588484	hsa-miR-3179	CLIP-seq
MIRT1215025	hsa-miR-3202	CLIP-seq
MIRT2588485	hsa-miR-320a	CLIP-seq
MIRT2588486	hsa-miR-320b	CLIP-seq
MIRT2588487	hsa-miR-320c	CLIP-seq
MIRT2588488	hsa-miR-320d	CLIP-seq
MIRT2588489	hsa-miR-4271	CLIP-seq
MIRT2588490	hsa-miR-4280	CLIP-seq
MIRT2588491	hsa-miR-4429	CLIP-seq
MIRT2588492	hsa-miR-4476	CLIP-seq
MIRT2588493	hsa-miR-4493	CLIP-seq
MIRT2588494	hsa-miR-4496	CLIP-seq
MIRT2588495	hsa-miR-4718	CLIP-seq
MIRT2588496	hsa-miR-4725-3p	CLIP-seq
MIRT2588497	hsa-miR-651	CLIP-seq
MIRT2588482	hsa-miR-3132	CLIP-seq
MIRT2588484	hsa-miR-3179	CLIP-seq
MIRT1215025	hsa-miR-3202	CLIP-seq
MIRT2588485	hsa-miR-320a	CLIP-seq
MIRT2588486	hsa-miR-320b	CLIP-seq
MIRT2588487	hsa-miR-320c	CLIP-seq
MIRT2588488	hsa-miR-320d	CLIP-seq
MIRT2588489	hsa-miR-4271	CLIP-seq
MIRT2588491	hsa-miR-4429	CLIP-seq
MIRT2588492	hsa-miR-4476	CLIP-seq
MIRT2588494	hsa-miR-4496	CLIP-seq
MIRT2588495	hsa-miR-4718	CLIP-seq
MIRT2588496	hsa-miR-4725-3p	CLIP-seq
MIRT2588497	hsa-miR-651	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: B3GLJ2
• Protein name: Prostate and testis expressed protein 3 (Acrosomal vesicle protein HEL-127) (PATE-like protein DJ) (PATE-DJ)
• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in prostate and testis. {ECO:0000269|PubMed:18387948}.
• Sequence:

  MNKHFLFLFLLYCLIVAVTSLQCITCHLRTRTDRCRRGFGVCTAQKGEACMLLRIYQRNT
  LQISYMVCQKFCRDMTFDLRNRTYVHTCCNYNYCNFKL

• Sequence length: 98

Pathways

KEGG Pathway:

Neuroactive ligand-receptor interaction

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

No strongly related genes found yet for PATE3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PATE3.