PASD1 (PAS domain containing repressor 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 139135
• Gene name: PAS domain containing repressor 1
• Gene symbol: PASD1
• Synonyms (NCBI Gene): CT63, CT64, OXTES1
• Chromosome: X
• Chromosome location: Xq28
• Summary: This gene encodes a protein that is thought to function as a transcription factor. The protein is a cancer-associated antigen that can stimulate autologous T-cell responses, and it is therefore considered to be a potential immunotherapeutic target for the

miRNA Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2061892	hsa-miR-3166	CLIP-seq
MIRT2061893	hsa-miR-3617	CLIP-seq
MIRT2061894	hsa-miR-3679-3p	CLIP-seq
MIRT2061895	hsa-miR-641	CLIP-seq
MIRT2290253	hsa-miR-1913	CLIP-seq
MIRT2290254	hsa-miR-324-3p	CLIP-seq
MIRT2290255	hsa-miR-4313	CLIP-seq
MIRT2290256	hsa-miR-4763-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0005634	Component	Nucleus	IDA	25936801
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0032922	Process	Circadian regulation of gene expression	IBA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0042754	Process	Negative regulation of circadian rhythm	IBA
GO:0042754	Process	Negative regulation of circadian rhythm	IDA	25936801
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	25936801
GO:0048511	Process	Rhythmic process	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	25936801
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	25936801
GO:1990512	Component	Cry-Per complex	IDA	25936801
GO:1990513	Component	CLOCK-BMAL transcription complex	IBA

Other IDs

• MIM: 300993
• HGNC: 20686
• e!Ensembl: ENSG00000166049

Protein

• UniProt ID: Q8IV76
• Protein name: Circadian clock protein PASD1 (Cancer/testis antigen 63) (CT63) (OX-TES-1) (PAS domain-containing protein 1)
• Protein function: Functions as a suppressor of the biological clock that drives the daily circadian rhythms of cells throughout the body (PubMed:25936801). Acts as a nuclear repressor of the CLOCK-BMAL1 heterodimer-mediated transcriptional activation of the core
• Tissue specificity: TISSUE SPECIFICITY: Testis-specific (PubMed:25936801). Expressed in a broad range of cancer cells, including melanoma, lung cancer, and breast cancer (at protein level). Testis-specific (PubMed:15162151). Found in histologically normal tissues from patien
• Sequence:

  MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAEN
  ISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLLNSETHIEFCCHLKRGNVEHG
  DSSAYENVKFIVNVRDICNEFPVVFSGLFSSHLCADFAACVPQEDRLYLVGNVCILRTQL
  LQQLYTSKAVSDEAVLTQDSDEEPFVGELSSSQGQRGHTSMKAVYVEPAAAAAAAAISDD
  QIDIAEVEQYGPQENVHMFVDSDSTYCSSTVFLDTMPESPALSLQDFRGEPEVNPLYRAD
  PVDLEFSVDQVDSVDQEGPMDQQDPENPVAPLDQAGLMDPVDPEDSVDLGAAGASAQPLQ
  PSSPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVV
  IPDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSLKNTGELQEPCVAFNQQ
  QLVQQEQHLKEQQRQLREQLQQLREQRKVQKQKKMQEKKKLQEQKMQEKKKLQEQRRQKK
  KKLQERKKWQGQMLQKEPEEEQQKQQLQEQPLKHNVIVGNERVQICLQNPRDVSVPLCNH
  PVRFLQAQPIVPVQRAAEQQPSGFYQDENCGQQEDESQSFYPEAYQGPPVNQLPLIDTSN
  SEAISSSSIPQFPITSDSTISTLETPQDYIRLWQELSDSLGPVVQVNTWSCDEQGTLHGQ
  PTYHQVQVSEVGVEGPPDPQAFQGPAAYQPDQMRSAEQTRLMPAEQRDSNKPC

• Sequence length: 773

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (12)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinogenesis	Carcinogenesis	Pubtator	31558691	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	19886887		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31478431		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15162151		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31558691		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31558691	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	19552722	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15162151		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15162151	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	20861911		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31558691		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20861911		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PASD1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PASD1.