Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	56288
Gene name	Par-3 family cell polarity regulator
Gene symbol	PARD3
Synonyms (NCBI Gene)	ASIPBazPAR3PAR3alphaPARD-3PARD3APPP1R118SE2-5L16SE2-5LT1SE2-5T2
Chromosome	10
Chromosome location	10p11.22-p11.21
Summary	This gene encodes a member of the PARD protein family. PARD family members interact with other PARD family members and other proteins; they affect asymmetrical cell division and direct polarized cell growth. Multiple alternatively spliced transcript varia

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs199923448	C>A,T	Risk-factor, uncertain-significance	Coding sequence variant, missense variant
rs557643577	A>G	Risk-factor	Intron variant
rs757259023	C>T	Risk-factor	Coding sequence variant, genic downstream transcript variant, missense variant
rs762921297	T>A	Risk-factor	Coding sequence variant, intron variant, missense variant
rs781461462	G>A,C,T	Pathogenic	Coding sequence variant, missense variant
rs1114167354	T>C	Pathogenic	Missense variant, coding sequence variant

150

Show/Hide all (150)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006686	hsa-miR-483-3p	qRT-PCRWestern blot	22101077
MIRT039030	hsa-miR-766-3p	CLASH	23622248
MIRT038900	hsa-miR-93-3p	CLASH	23622248
MIRT692565	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT692564	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT692563	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT692562	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT692561	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT692560	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT692559	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT692558	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT692557	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT692556	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT692555	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT692554	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT692553	hsa-miR-302e	HITS-CLIP	23313552
MIRT692552	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT692551	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT692550	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT692549	hsa-miR-520b	HITS-CLIP	23313552
MIRT692548	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT692547	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT692546	hsa-miR-520e	HITS-CLIP	23313552
MIRT692545	hsa-miR-4438	HITS-CLIP	23313552
MIRT692544	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT692543	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT692542	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT692541	hsa-miR-520h	HITS-CLIP	23313552
MIRT692540	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT692539	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT692538	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT692537	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT692536	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT692535	hsa-miR-1254	HITS-CLIP	23313552
MIRT692534	hsa-miR-3116	HITS-CLIP	23313552
MIRT692533	hsa-miR-661	HITS-CLIP	23313552
MIRT692532	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT692531	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT692530	hsa-miR-2861	HITS-CLIP	23313552
MIRT692529	hsa-miR-5095	HITS-CLIP	23313552
MIRT692528	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT692527	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT692526	hsa-miR-6796-3p	HITS-CLIP	23313552
MIRT692525	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT692524	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT692523	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT692522	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT692521	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT692520	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT692519	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT692518	hsa-miR-7158-5p	HITS-CLIP	23313552
MIRT692517	hsa-miR-3194-3p	HITS-CLIP	23313552
MIRT692516	hsa-miR-629-5p	HITS-CLIP	23313552
MIRT692515	hsa-miR-6792-5p	HITS-CLIP	23313552
MIRT692514	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT692513	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT692512	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT692511	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT692510	hsa-miR-6839-3p	HITS-CLIP	23313552
MIRT692509	hsa-miR-4503	HITS-CLIP	23313552
MIRT440043	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440043	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT692565	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT692564	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT692563	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT692562	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT692561	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT692560	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT692559	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT692558	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT692557	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT692556	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT692555	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT692554	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT692553	hsa-miR-302e	HITS-CLIP	23313552
MIRT692552	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT692551	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT692550	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT692549	hsa-miR-520b	HITS-CLIP	23313552
MIRT692548	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT692547	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT692546	hsa-miR-520e	HITS-CLIP	23313552
MIRT692545	hsa-miR-4438	HITS-CLIP	23313552
MIRT692544	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT692543	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT692542	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT692541	hsa-miR-520h	HITS-CLIP	23313552
MIRT692540	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT692539	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT692538	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT692537	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT692536	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT692535	hsa-miR-1254	HITS-CLIP	23313552
MIRT692534	hsa-miR-3116	HITS-CLIP	23313552
MIRT692533	hsa-miR-661	HITS-CLIP	23313552
MIRT692532	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT692531	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT692530	hsa-miR-2861	HITS-CLIP	23313552
MIRT692529	hsa-miR-5095	HITS-CLIP	23313552
MIRT692528	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT692527	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT692526	hsa-miR-6796-3p	HITS-CLIP	23313552
MIRT692525	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT692524	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT692523	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT692522	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT692521	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT692520	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT692519	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT692518	hsa-miR-7158-5p	HITS-CLIP	23313552
MIRT692517	hsa-miR-3194-3p	HITS-CLIP	23313552
MIRT692516	hsa-miR-629-5p	HITS-CLIP	23313552
MIRT692515	hsa-miR-6792-5p	HITS-CLIP	23313552
MIRT692514	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT692513	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT692512	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT692511	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT692510	hsa-miR-6839-3p	HITS-CLIP	23313552
MIRT692509	hsa-miR-4503	HITS-CLIP	23313552
MIRT1213613	hsa-miR-200b	CLIP-seq
MIRT1213614	hsa-miR-200c	CLIP-seq
MIRT1213615	hsa-miR-429	CLIP-seq
MIRT1213616	hsa-miR-603	CLIP-seq
MIRT1213617	hsa-miR-3145-5p	CLIP-seq
MIRT1213618	hsa-miR-508-5p	CLIP-seq
MIRT1213619	hsa-miR-4666-3p	CLIP-seq
MIRT1213620	hsa-miR-505	CLIP-seq
MIRT1213621	hsa-miR-3074-5p	CLIP-seq
MIRT1213622	hsa-miR-4715-3p	CLIP-seq
MIRT1213623	hsa-miR-4722-3p	CLIP-seq
MIRT1213624	hsa-miR-516a-3p	CLIP-seq
MIRT2061517	hsa-miR-124	CLIP-seq
MIRT2061518	hsa-miR-425	CLIP-seq
MIRT2061519	hsa-miR-506	CLIP-seq
MIRT2061520	hsa-miR-298	CLIP-seq
MIRT2061521	hsa-miR-4462	CLIP-seq
MIRT2061522	hsa-miR-602	CLIP-seq
MIRT2061523	hsa-miR-642b	CLIP-seq
MIRT2587915	hsa-miR-1245b-3p	CLIP-seq
MIRT2587916	hsa-miR-219-5p	CLIP-seq
MIRT2587917	hsa-miR-4445	CLIP-seq
MIRT2587918	hsa-miR-4782-3p	CLIP-seq
MIRT2587919	hsa-miR-508-3p	CLIP-seq
MIRT2587920	hsa-miR-513a-5p	CLIP-seq
MIRT2587915	hsa-miR-1245b-3p	CLIP-seq
MIRT2587916	hsa-miR-219-5p	CLIP-seq
MIRT2587917	hsa-miR-4445	CLIP-seq
MIRT2587918	hsa-miR-4782-3p	CLIP-seq
MIRT2587919	hsa-miR-508-3p	CLIP-seq
MIRT2587920	hsa-miR-513a-5p	CLIP-seq

Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0005515	Function	Protein binding	IPI	10934474, 11257119, 14676191, 15161933, 15254234, 15778465, 17057644, 17979178, 18838552, 19893486, 22579248, 22653443, 26496610, 26766442, 28514442, 31980649, 33961781, 35271311, 36931259
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	ISS
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	20332120
GO:0005911	Component	Cell-cell junction	IEA
GO:0005911	Component	Cell-cell junction	ISS
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IEA
GO:0005923	Component	Bicellular tight junction	IDA	14676191, 22006950
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005923	Component	Bicellular tight junction	ISS
GO:0005923	Component	Bicellular tight junction	TAS	10934474
GO:0005938	Component	Cell cortex	IBA
GO:0005938	Component	Cell cortex	IEA
GO:0006612	Process	Protein targeting to membrane	ISS
GO:0007155	Process	Cell adhesion	IBA
GO:0007163	Process	Establishment or maintenance of cell polarity	IEA
GO:0007163	Process	Establishment or maintenance of cell polarity	TAS	10934474, 14676191
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	11260256
GO:0007409	Process	Axonogenesis	TAS	14676191
GO:0008104	Process	Intracellular protein localization	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0008356	Process	Asymmetric cell division	TAS	10934474
GO:0010801	Process	Negative regulation of peptidyl-threonine phosphorylation	ISS
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0022011	Process	Myelination in peripheral nervous system	ISS
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030054	Component	Cell junction	IDA
GO:0030054	Component	Cell junction	TAS
GO:0030154	Process	Cell differentiation	IEA
GO:0031643	Process	Positive regulation of myelination	ISS
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	ISS
GO:0033269	Component	Internode region of axon	ISS
GO:0035091	Function	Phosphatidylinositol binding	IBA
GO:0043296	Component	Apical junction complex	IBA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	IBA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	IDA	11257119
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	ISS
GO:0051301	Process	Cell division	IEA
GO:0051660	Process	Establishment of centrosome localization	IBA
GO:0065003	Process	Protein-containing complex assembly	TAS	10934474
GO:0070160	Component	Tight junction	NAS	11257119
GO:0070161	Component	Anchoring junction	IEA
GO:0070830	Process	Bicellular tight junction assembly	ISS
GO:0090162	Process	Establishment of epithelial cell polarity	ISS
GO:0120157	Component	PAR polarity complex	IPI	11257119
GO:0120157	Component	PAR polarity complex	ISS

MIM	HGNC	e!Ensembl
606745	16051	ENSG00000148498

Q8TEW0

Protein name

Partitioning defective 3 homolog (PAR-3) (PARD-3) (Atypical PKC isotype-specific-interacting protein) (ASIP) (CTCL tumor antigen se2-5) (PAR3-alpha)

Protein function

Adapter protein involved in asymmetrical cell division and cell polarization processes (PubMed:10954424, PubMed:27925688). Seems to play a central role in the formation of epithelial tight junctions (PubMed:27925688). Targets the phosphatase PTE

PDB

2KOM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12053	Par3_HAL_N_term	1 → 83	N-terminal of Par3 and HAL proteins	Family
PF00595	PDZ	461 → 545	PDZ domain	Domain
PF00595	PDZ	590 → 680	PDZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12234671}.

Sequence

MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDE
DGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAME
TLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGR
ESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGL
GDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDY
AEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSP
VDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVE
VQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPS
YAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS

Sequence length

1356

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neural tube defect	Pathogenic	rs781461462, rs1114167354	RCV000490790 RCV000490779	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARREST	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARD3-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian failure	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (122)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12518376, 26457809, 28060110, 28440015, 29165013, 29217160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	24386489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16320248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	29220829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12518376, 28060110, 28440015, 29165013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27072891	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	12684256, 15033338, 15885796, 20132478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28096290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30171257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	Pubtator	28623428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29735171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	28844109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	24385683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29735171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19592499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	18488027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30336339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34023783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24856572, 28844109, 33172988, 34023783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	33248005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23322019, 34040099, 36105681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24856572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20215515, 25303977, 27424798, 33172988, 34216486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	18488027, 19384953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	CTD_human_DG	18488027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27855669, 28148395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	20930120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	37878141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	17989107, 20096742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	24386489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	30786942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10910927, 12518376, 19741605, 28060110, 28440015, 29165013		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23948443, 24331409, 31308265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28844109, 31308265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital meningocele	Congenital Meningocele	BEFREE	8740138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27623354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24782052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	18488027, 19710684, 21693730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	31409654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	36313742	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25202993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25448265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermoid Cyst	Dermoid Cyst	BEFREE	8740138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37878141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	20096742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29206870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28148395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28526815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	22011642, 22130450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20215515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20215515, 22952576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28827518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	BEFREE	15998953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21515326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24386489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27885727, 9490695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16091846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	29217160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25448265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	31570005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23153534, 30336339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29206870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27855669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19737411, 29017577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	28319090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	18488027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19384953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28400336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25833829, 29113054, 29789715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	7757071		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11833005, 15998953, 18488027, 18641652, 19384953, 21693730, 22628150, 23537197, 28096290		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18488027		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	18488027, 18641652, 21983785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21983785, 33248005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25448265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial cardiomyopathy	Mitochondrial Cardiomyopathy	BEFREE	8687011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	25447692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31194992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31194992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20215515, 20442298, 23153534, 23948443, 25833829, 28188749, 28526815, 30848088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	22447895, 27925688, 28369449, 28623428, 30256191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural tube defect	Pubtator	28623428, 34092257	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24331409, 25173530, 26860843, 27127129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	12055320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12438443, 30670780, 31794826, 8772727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35534464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27855669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27855669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31515171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24439955		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritonitis	Peritonitis	Pubtator	27855669	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26457809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29217160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26457809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	8687011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19737411, 29017577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	30467379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19737411	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	28319090		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30467379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	23303587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23739922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11743661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20442298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14872483, 29735171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10924404, 25720829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	18488027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	21221757, 25705849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	29789715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19384953, 20215515, 25833829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19503097, 28188749, 28526815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25303977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28400336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30171257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30171257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29581274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29581274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17989107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	24890271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	18282185		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18282185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	28916831		★★★★★ ★☆☆☆☆ Found in Text Mining only

PARD3 (par-3 family cell polarity regulator)