PAPPA-AS1 (PAPPA antisense RNA 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 493913 |
| Gene name | PAPPA antisense RNA 1 |
| Gene symbol | PAPPA-AS1 |
| Synonyms (NCBI Gene) |
DIPASNCRNA00156PAPPA-ASPAPPAASPAPPASTAF2C2TAF4BTAFII105
|
| Chromosome | 9 |
| Chromosome location | 9q33.1 |
|
miRNA
miRNA information provided by mirtarbase database.
60
|
|||||||||||||||||||||||||
|
|||||||||||||||||||||||||
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
|
|||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q5QFB9 |
| Protein name | Protein PAPPAS (DIPLA1 antisense RNA 1) (DIPLA1 antisense gene protein 1) (DIPLA1-antisense expressed) (PAPPAS antisense RNA 1) (PAPPAS antisense gene protein 1) (PAPPAS-antisense expressed) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in placenta with lower expression in brain, kidney and testis. {ECO:0000269|PubMed:15656990}. |
| Sequence |
MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLS |
| Sequence length | 102 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with PAPPA-AS1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to PAPPA-AS1 (see Related Genes above), that are NOT already directly curated for PAPPA-AS1 itself -- a lead worth checking, not a confirmed association.
0
|
|