PANO1 (proapoptotic nucleolar protein 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 101927423
Gene name Proapoptotic nucleolar protein 1
Gene symbol PANO1
Synonyms (NCBI Gene)
PANO
Chromosome 11
Chromosome location 11p15.5
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005730 Component Nucleolus IDA 22094112
GO:0005730 Component Nucleolus IEA
GO:0006915 Process Apoptotic process IEA
GO:0031647 Process Regulation of protein stability IDA 22094112
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620541 51237 ENSG00000288675
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
I0J062
Protein name Proapoptotic nucleolar protein 1
Protein function Apoptosis-inducing protein that modulates the tumor suppressor function of CDKN2A/p14ARF. Enhances the stability of CDKN2A/p14ARF protein by protecting it from degradation. May act as a tumor suppressor (PubMed:22094112). {ECO:0000269|PubMed:220
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:22094112}.
Sequence 
MGVRLRVWPAAPHSISRCPRPLGAVLSILLAGGSRKGTPTARCLGQRTKEKRVGGRSLRS
EAGSGPCPTAGAQPTAPSSAWPPRLRPRTCPQMSGELPRVRPTRVGLSSLGSGPGHPPSG
TRMCGERARNRRGRARRLTPEQPRIGASAGPGPPLPPARPRCSGSCHLPRPPQHLSPPQP
GRVRMGAAEGSRRADTHHARRRRRARLPAPRSAST
Sequence length 215
Interactions View interactions

No strongly related genes found yet for PANO1.

No additional diseases found yet through genes similar to PANO1.