Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	90737
Gene name	PAGE family member 5
Gene symbol	PAGE5
Synonyms (NCBI Gene)	CT16CT16.1CT16.2GAGEE1PAGE-5
Chromosome	X
Chromosome location	Xp11.21
Summary	This gene is a member of family of proteins that are expressed in a variety of tumors and in some fetal and reproductive tissues. The encoded protein may protect cells from programmed cell death. Multiple alternatively spliced transcript variants encoding

7 Show/Hide all (7)

miRTarBase ID	miRNA	Experiments
MIRT1210743	hsa-miR-298	CLIP-seq
MIRT1210744	hsa-miR-3607-3p	CLIP-seq
MIRT1210745	hsa-miR-3678-3p	CLIP-seq
MIRT1210746	hsa-miR-548a-3p	CLIP-seq
MIRT1210747	hsa-miR-548e	CLIP-seq
MIRT1210748	hsa-miR-548f	CLIP-seq
MIRT1210749	hsa-miR-548g	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21044950, 32296183

MIM	HGNC	e!Ensembl
301009	29992	ENSG00000158639

Protein name

P antigen family member 5 (PAGE-5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate-associated gene 5 protein)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05831	GAGE	21 → 126	GAGE protein	Family

Sequence

MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEE
PPTDNQGIAPSGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPT
KVLEAGEGQL

Sequence length

130

Interactions

View interactions

Related Genes Genes most often co-reported with PAGE5 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PAGE5.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PAGE5 (see Related Genes above), that are NOT already directly curated for PAGE5 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PAGE5.

PAGE5 (PAGE family member 5)