PABIR1 (PP2A Aalpha (PPP2R1A) and B55A (PPP2R2A) interacting phosphatase regulator 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 116224
Gene name PP2A Aalpha (PPP2R1A) and B55A (PPP2R2A) interacting phosphatase regulator 1
Gene symbol PABIR1
Synonyms (NCBI Gene)
C9orf42FAM122A
Chromosome 9
Chromosome location 9q21.11
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19 Show/Hide all (19)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004864 Function Protein phosphatase inhibitor activity IDA 38123684
GO:0004864 Function Protein phosphatase inhibitor activity IEA
GO:0004864 Function Protein phosphatase inhibitor activity IMP 38123684
GO:0004865 Function Protein serine/threonine phosphatase inhibitor activity IEA
GO:0004865 Function Protein serine/threonine phosphatase inhibitor activity IMP 27588481, 33108758
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617249 23490 ENSG00000187866
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96E09
Protein name PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 (PABIR family member 1)
Protein function Acts as an inhibitor of serine/threonine-protein phosphatase 2A (PP2A) activity (PubMed:27588481, PubMed:33108758, PubMed:38123684). Inhibits PP2A activity by blocking the substrate binding site on PPP2R2A and the active site of PPP2CA (PubMed:3
PDB 8SO0 , 8TWE , 8TWI
Family and domains
Sequence 
MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARR
NSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEES
FSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTT
RFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVS
SDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK
Sequence length 287
Interactions View interactions

No strongly related genes found yet for PABIR1.

No additional diseases found yet through genes similar to PABIR1.